Tested Applications
Positive WB detected in | A-253 cells, A431 cells, MDA-MB-231 cells, SKOV-3 cells, HH cells, HFF cells, HaCaT cells, MJ cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
27534-1-AP targets TMEM45A in WB, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24392 Product name: Recombinant human TMEM45A protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 229-275 aa of BC040355 Sequence: YAVTIVIVGMNYAFITWLVKSRLKRLCSSEVGLLKNAEREQESEEEM Predict reactive species |
Full Name | transmembrane protein 45A |
Observed Molecular Weight | 70-75 kDa |
GenBank Accession Number | BC040355 |
Gene Symbol | TMEM45A |
Gene ID (NCBI) | 55076 |
RRID | AB_3669609 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9NWC5 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TMEM45A, also known as DERP7, DNAPTP4, or FLJ10134, is a transmembrane protein belonging to the TMEM family. TMEM45A is highly expressed in keratinocytes and its expression correlates with keratinization, suggesting a role in normal epidermal physiology(PMID: 22954140; PMID: 24689342). TMEM45A promotes cell proliferation, migration, and invasion in glioblastoma cells, favors epithelial-mesenchymal transition (EMT) in colorectal cancer and promotes cell proliferation by favoring the G1/S cell cycle transition in ovarian cancer cells (PMID: 37936608). The predicted molecular weight of TMEM45A is 32 kDa, and 66-98 kDa has been reported in the literature(PMID: 22954140).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TMEM45A antibody 27534-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |