TMEM50B Polyclonal antibody, PBS Only

TMEM50B Polyclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 15941-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

15941-1-PBS targets TMEM50B in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8220

Product name: Recombinant human TMEM50B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-158 aa of BC000569

Sequence: MAGFLDNFRWPECECIDWSERRNAVASVVAGILFFTGWWIMIDAAVVYPKPEQLNHAFHTCGVFSTLAFFMINAVSNAQVRGDSYESGCLGRTGARVWLFIGFMLMFGSLIASMWILFGAYVTQNTDVYPGLAVFFQNALIFFSTLIYKFGRTEELWT

Predict reactive species
Full Name transmembrane protein 50B
Calculated Molecular Weight 15 kDa
Observed Molecular Weight 14 kDa, 30 kDa, 50 kDa
GenBank Accession NumberBC000569
Gene Symbol TMEM50B
Gene ID (NCBI) 757
RRIDAB_2205161
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP56557
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

TMEM50B, originally referred to as C21orf4, is a predicted transmembrane protein, estimated to contain four transmembrane-spanning domains with both the carboxy- and amino-terminals being cytoplasmic (PMID: 10077530; 18541381). Human TMEM50B shares sequence homologies of around 90-100% with mouse and rat Tmem50b. In a Down syndrome mouse model, Ts1Cje, Tmem50b is shown to be one of the few genes significantly over-expressed during cerebellar development (PMID: 15590701). It has been reported that rodent Tmem50b is a developmentally-regulated intracellular ER and Golgi apparatus membrane protein that may prove important for correct brain development through functions associated with precursor cells and glia (PMID: 18541381). TMEM50B can exist as a dimer and a trimer conformation (PMID: 18541381).

Loading...
||
New chat Able
正在加载,请稍候...