TMEM50B Polyclonal antibody

TMEM50B Polyclonal Antibody for WB, IHC, ELISA
Cat No. 15941-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

C21orf4, HCVP7TP3, TMEM50B, transmembrane protein 50B

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse testis tissue, mouse heart tissue
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:300-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15941-1-AP targets TMEM50B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8220

Product name: Recombinant human TMEM50B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-158 aa of BC000569

Sequence: MAGFLDNFRWPECECIDWSERRNAVASVVAGILFFTGWWIMIDAAVVYPKPEQLNHAFHTCGVFSTLAFFMINAVSNAQVRGDSYESGCLGRTGARVWLFIGFMLMFGSLIASMWILFGAYVTQNTDVYPGLAVFFQNALIFFSTLIYKFGRTEELWT

Predict reactive species
Full Name transmembrane protein 50B
Calculated Molecular Weight 15 kDa
Observed Molecular Weight 14 kDa, 30 kDa, 50 kDa
GenBank Accession NumberBC000569
Gene Symbol TMEM50B
Gene ID (NCBI) 757
RRIDAB_2205161
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP56557
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TMEM50B, originally referred to as C21orf4, is a predicted transmembrane protein, estimated to contain four transmembrane-spanning domains with both the carboxy- and amino-terminals being cytoplasmic (PMID: 10077530; 18541381). Human TMEM50B shares sequence homologies of around 90-100% with mouse and rat Tmem50b. In a Down syndrome mouse model, Ts1Cje, Tmem50b is shown to be one of the few genes significantly over-expressed during cerebellar development (PMID: 15590701). It has been reported that rodent Tmem50b is a developmentally-regulated intracellular ER and Golgi apparatus membrane protein that may prove important for correct brain development through functions associated with precursor cells and glia (PMID: 18541381). TMEM50B can exist as a dimer and a trimer conformation (PMID: 18541381).

Protocols

Product Specific Protocols
WB protocol for TMEM50B antibody 15941-1-APDownload protocol
IHC protocol for TMEM50B antibody 15941-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...