TMEM50B Polyclonal antibody

• 

  WB analysis of mouse testis using 15941-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 15941-1-AP (TMEM50B antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 15941-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 15941-1-AP (TMEM50B antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse heart using 15941-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 15941-1-AP (TMEM50B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 15941-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15941-1-AP (TMEM50B antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 15941-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15941-1-AP (TMEM50B antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TMEM50B Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15941-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

C21orf4, HCVP7TP3, TMEM50B, transmembrane protein 50B

---

Tested Applications

• Positive WB detected in: mouse testis tissue, mouse heart tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:300-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15941-1-AP targets TMEM50B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8220

  Product name: Recombinant human TMEM50B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-158 aa of BC000569

  Sequence: MAGFLDNFRWPECECIDWSERRNAVASVVAGILFFTGWWIMIDAAVVYPKPEQLNHAFHTCGVFSTLAFFMINAVSNAQVRGDSYESGCLGRTGARVWLFIGFMLMFGSLIASMWILFGAYVTQNTDVYPGLAVFFQNALIFFSTLIYKFGRTEELWT

• Full Name: transmembrane protein 50B
• Calculated Molecular Weight: 15 kDa
• Observed Molecular Weight: 14 kDa, 30 kDa, 50 kDa
• GenBank Accession Number: BC000569
• Gene Symbol: TMEM50B
• Gene ID (NCBI): 757
• RRID: AB_2205161
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P56557
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TMEM50B, originally referred to as C21orf4, is a predicted transmembrane protein, estimated to contain four transmembrane-spanning domains with both the carboxy- and amino-terminals being cytoplasmic (PMID: 10077530; 18541381). Human TMEM50B shares sequence homologies of around 90-100% with mouse and rat Tmem50b. In a Down syndrome mouse model, Ts1Cje, Tmem50b is shown to be one of the few genes significantly over-expressed during cerebellar development (PMID: 15590701). It has been reported that rodent Tmem50b is a developmentally-regulated intracellular ER and Golgi apparatus membrane protein that may prove important for correct brain development through functions associated with precursor cells and glia (PMID: 18541381). TMEM50B can exist as a dimer and a trimer conformation (PMID: 18541381).