Product Information
24920-1-AP targets TMEM55A in ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20686 Product name: Recombinant human TMEM55A protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 203-257 aa of BC033892 Sequence: IFIGVGLTVGTPDFARRFRATYVSWAIAYLLGLICLIRACYWGAIRVSYPEHSFA Predict reactive species |
| Full Name | transmembrane protein 55A |
| Calculated Molecular Weight | 257 aa, 28 kDa |
| GenBank Accession Number | BC033892 |
| Gene Symbol | TMEM55A |
| Gene ID (NCBI) | 55529 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8N4L2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
