Filter:
Tested Applications
| Positive WB detected in | mouse brain tissue, unboiled mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
23115-1-AP targets TMEM63C in WB, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19428 Product name: Recombinant human TMEM63C protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 693-806 aa of BC136613 Sequence: LLIAMVIAFVGIFLGKLRMVADYEPEEEEIQTVFDMEPSSTSSTPTSLLYVATVLQEPELNLTPASSPARHTYGTMNNQPEEGEEESGLRGFARELDSAQFQEGLELEGQNQYH Predict reactive species |
| Full Name | transmembrane protein 63C |
| Calculated Molecular Weight | 806 aa, 93 kDa |
| Observed Molecular Weight | 93 kDa |
| GenBank Accession Number | BC136613 |
| Gene Symbol | TMEM63C |
| Gene ID (NCBI) | 57156 |
| RRID | AB_3085706 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | Q9P1W3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TMEM63C, also known as CSC1, is a member of the TMEM family. TMEM63C is expressed in kidney and associated with podocyte function (PMID: 32750436). Patients with focal segmental glomerulosclerosis exhibited specific TMEM63C loss in podocytes.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for TMEM63C antibody 23115-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
