Tested Applications
Positive WB detected in | A2780 cells, Jurkat cells |
Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 5 publications below |
Product Information
20388-1-AP targets TMEM70 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14226 Product name: Recombinant human TMEM70 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 148-260 aa of BC002748 Sequence: MGSFTVITPVLLHFITKGYVIRLYHEATTDTYKAITYNAMLAETSTVFHQNDVKIPDAKHVFTTFYAKTKSLLVNPVLFPNREDYIHLMGYDKEEFILYMEETSEEKRHKDDK Predict reactive species |
Full Name | transmembrane protein 70 |
Calculated Molecular Weight | 260 aa, 29 kDa |
Observed Molecular Weight | 18 kDa |
GenBank Accession Number | BC002748 |
Gene Symbol | TMEM70 |
Gene ID (NCBI) | 54968 |
RRID | AB_10694436 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9BUB7 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TMEM70 belongs to the TMEM70 family. It is involved in biogenesis of mitochondrial ATP synthase. Defects in TMEM70 are a cause of mitochondrial encephalocardiomyopathy neonatal due to ATP synthase deficiency (MT-ATPSD). A publication(PMID:21147908) identifies that TMEM70 gene defect as a pan-ethnic disorder and further redefines it as the most common cause of nuclear-origin ATP synthase deficiency.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TMEM70 antibody 20388-1-AP | Download protocol |
IHC protocol for TMEM70 antibody 20388-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Inflammation IRF-1 Regulates Mitochondrial Respiration and Intrinsic Apoptosis Under Metabolic Stress through ATP Synthase Ancillary Factor TMEM70
| ||
Neurogenetics TMEM70: a mutational hot spot in nuclear ATP synthase deficiency with a pivotal role in complex V biogenesis. | ||
JIMD Rep Common and Novel TMEM70 Mutations in a Cohort of Italian Patients with Mitochondrial Encephalocardiomyopathy. | ||
Life Sci Alliance Mitochondrial stress response triggered by defects in protein synthesis quality control.
|