Tested Applications
| Positive WB detected in | A2780 cells, Jurkat cells |
| Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20388-1-AP targets TMEM70 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14226 Product name: Recombinant human TMEM70 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 148-260 aa of BC002748 Sequence: MGSFTVITPVLLHFITKGYVIRLYHEATTDTYKAITYNAMLAETSTVFHQNDVKIPDAKHVFTTFYAKTKSLLVNPVLFPNREDYIHLMGYDKEEFILYMEETSEEKRHKDDK Predict reactive species |
| Full Name | transmembrane protein 70 |
| Calculated Molecular Weight | 260 aa, 29 kDa |
| Observed Molecular Weight | 18 kDa |
| GenBank Accession Number | BC002748 |
| Gene Symbol | TMEM70 |
| Gene ID (NCBI) | 54968 |
| RRID | AB_10694436 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9BUB7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TMEM70 belongs to the TMEM70 family. It is involved in biogenesis of mitochondrial ATP synthase. Defects in TMEM70 are a cause of mitochondrial encephalocardiomyopathy neonatal due to ATP synthase deficiency (MT-ATPSD). A publication(PMID:21147908) identifies that TMEM70 gene defect as a pan-ethnic disorder and further redefines it as the most common cause of nuclear-origin ATP synthase deficiency.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TMEM70 antibody 20388-1-AP | Download protocol |
| IHC protocol for TMEM70 antibody 20388-1-AP | Download protocol |
| WB protocol for TMEM70 antibody 20388-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
TMEM70 Polyclonal antibody (Cat# 20388-1-AP) has 5 total citations appearing in Mitochondrion, Inflammation, Life Science Alliance, JIMD Reports, and Neurogenetics. The associated research fields include mitochondrial membrane assembly, mitochondrial respiration and intrinsic apoptosis under metabolic stress, protein synthesis quality control, mitochondrial encephalocardiomyopathy, and ATP synthase complex V biogenesis.
| Species | Application | Title |
|---|---|---|
Inflammation IRF-1 Regulates Mitochondrial Respiration and Intrinsic Apoptosis Under Metabolic Stress through ATP Synthase Ancillary Factor TMEM70
| ||
Life Sci Alliance Mitochondrial stress response triggered by defects in protein synthesis quality control.
| ||
Neurogenetics TMEM70: a mutational hot spot in nuclear ATP synthase deficiency with a pivotal role in complex V biogenesis. | ||
JIMD Rep Common and Novel TMEM70 Mutations in a Cohort of Italian Patients with Mitochondrial Encephalocardiomyopathy. |
