TMEM74 Monoclonal antibody

• 

  WB analysis of LNCaP using 67773-1-Ig

  LNCaP cells were subjected to SDS PAGE followed by western blot with 67773-1-Ig (TMEM74 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of L02 using 67773-1-Ig

  L02 cells were subjected to SDS PAGE followed by western blot with 67773-1-Ig (TMEM74 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 67773-1-Ig

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 67773-1-Ig (TMEM74 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

TMEM74 Monoclonal Antibody for WB, ELISA

Cat No. 67773-1-Ig

Clone No.2H1B7

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, ELISA

Synonyms

FLJ30668, TMEM74, transmembrane protein 74

---

Tested Applications

• Positive WB detected in: LNCaP cells, L02 cells, HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

67773-1-Ig targets TMEM74 in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22359

  Product name: Recombinant human TMEM74 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-187 aa of BC030710

  Sequence: MELHYLAKKSNQADLCDARDWSSRGLPGDQADTAATRAALCCQKQCASTPRATEMEGSKLSSSPASPSSSLQNSTLQPDAFPPGLLHSGNNQITAERKVCNCCSQELETSFTYVDKNINLEQRNRSSPSAKGHNHPGELGWENPNEWSQEAAISLISEEEDDTSSEATSSGKSIDYGFISAILFLVT

• Full Name: transmembrane protein 74
• Calculated Molecular Weight: 305 aa, 33 kDa
• Observed Molecular Weight: 33 kDa
• GenBank Accession Number: BC030710
• Gene Symbol: TMEM74
• Gene ID (NCBI): 157753
• RRID: AB_2918538
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q96NL1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Transmembrane protein 74 (TMEM74), plays an essential role in autophagy during cell starvation and other stress conditions. TMEM74 is localized to the lysosome and autophagosome. It has been rreported that TMEM74-induced autophagy may be associated with PI3K signal transduction. (PMID: 19029833, 18294959)