Product Information
67773-1-PBS targets TMEM74 in WB, Indirect ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22359 Product name: Recombinant human TMEM74 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-187 aa of BC030710 Sequence: MELHYLAKKSNQADLCDARDWSSRGLPGDQADTAATRAALCCQKQCASTPRATEMEGSKLSSSPASPSSSLQNSTLQPDAFPPGLLHSGNNQITAERKVCNCCSQELETSFTYVDKNINLEQRNRSSPSAKGHNHPGELGWENPNEWSQEAAISLISEEEDDTSSEATSSGKSIDYGFISAILFLVT Predict reactive species |
| Full Name | transmembrane protein 74 |
| Calculated Molecular Weight | 305 aa, 33 kDa |
| Observed Molecular Weight | 33 kDa |
| GenBank Accession Number | BC030710 |
| Gene Symbol | TMEM74 |
| Gene ID (NCBI) | 157753 |
| RRID | AB_2918538 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q96NL1 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Transmembrane protein 74 (TMEM74), plays an essential role in autophagy during cell starvation and other stress conditions. TMEM74 is localized to the lysosome and autophagosome. It has been rreported that TMEM74-induced autophagy may be associated with PI3K signal transduction. (PMID: 19029833, 18294959)





