TMEM85 Polyclonal antibody

• 

  WB analysis using 27708-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27708-1-AP (TMEM85 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human brain using 27708-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 27708-1-AP (TMEM85 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human brain using 27708-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 27708-1-AP (TMEM85 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TMEM85 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27708-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

Human, Mouse, rat and More (1)

Applications

WB, IHC, ELISA

Synonyms

EMC4, ER membrane protein complex subunit 4, PIG17, TMEM85, transmembrane protein 85

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HepG2 cells, mouse heart tissue, rat heart tissue
• Positive IHC detected in: human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below

Product Information

27708-1-AP targets TMEM85 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, rat samples.

• Tested Reactivity: Human, Mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26785

  Product name: Recombinant human TMEM85 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-70 aa of BC002583

  Sequence: MTAQGGLVANRGRRFKWAIELSGPGGGSRGRSDRGSGQGDSLYPVGYLDKQVPDTSVQETDRILVEKRCW

• Full Name: transmembrane protein 85
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC002583
• Gene Symbol: TMEM85
• Gene ID (NCBI): 51234
• RRID: AB_2880950
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5J8M3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; WNK1 is an assembly factor for the human ER membrane protein complex.; Authors - Tino Pleiner
human	WB	J Cell Biol; A selectivity filter in the ER membrane protein complex limits protein misinsertion at the ER; Authors - Tino Pleiner
human	WB	bioRxiv; Role of a holo-insertase complex in the biogenesis of biophysically diverse ER membrane proteins; Authors - Katharine R Page