TMEM85 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TMEM85 Polyclonal antibody (27708-1-AP)

TMEM85 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27708-1-AP Copied!

Publications (5)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Cell proliferation-inducing gene 17 protein, EMC4, ER membrane protein complex subunit 4, HSPC184, PIG17

• 

  WB analysis using 27708-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27708-1-AP (TMEM85 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 27708-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 27708-1-AP (TMEM85 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human brain using 27708-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 27708-1-AP (TMEM85 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 27708-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 27708-1-AP (TMEM85 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 27708-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27708-1-AP (TMEM85 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat brain using 27708-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 27708-1-AP (TMEM85 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat heart using 27708-1-AP

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 27708-1-AP (TMEM85 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TMEM85 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, HepG2 cells, mouse heart tissue, rat heart tissue
• Positive IHC detected in: human brain tissue, rat heart tissue, mouse brain tissue, human stomach cancer tissue, rat brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27708-1-AP targets TMEM85 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26785

  Product name: Recombinant human TMEM85 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-70 aa of BC002583

  Sequence: MTAQGGLVANRGRRFKWAIELSGPGGGSRGRSDRGSGQGDSLYPVGYLDKQVPDTSVQETDRILVEKRCW

• Full Name: transmembrane protein 85
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC002583
• Gene Symbol: TMEM85
• Gene ID (NCBI): 51234
• RRID: AB_2880950
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5J8M3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The TMEM85 Polyclonal antibody (Cat# 27708-1-AP) has 5 citations published in Nature Communications, Molecular Cell, Journal of Cell Biology, and bioRxiv. The cited research focuses on ER membrane protein biogenesis, including insertase complex assembly, protein misinsertion at the ER, and a VDAC ligand's role in disrupting calcium homeostasis to induce selective cancer cell death. All citations used the antibody for Western blot in human samples.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; A small molecule VDAC ligand inhibits ERAD and induces selective cancer cell death via disruption of calcium homeostasis.; Authors - Wenjing Yan
human	WB	Mol Cell; WNK1 is an assembly factor for the human ER membrane protein complex.; Authors - Tino Pleiner
human	WB	Mol Cell; Role of a holo-insertase complex in the biogenesis of biophysically diverse ER membrane proteins.; Authors - Katharine R. Page ; KD Validated
human	WB	J Cell Biol; A selectivity filter in the ER membrane protein complex limits protein misinsertion at the ER; Authors - Tino Pleiner
human	WB	bioRxiv; Role of a holo-insertase complex in the biogenesis of biophysically diverse ER membrane proteins; Authors - Katharine R Page