Tested Applications
Positive WB detected in | HEK-293 cells, HepG2 cells, mouse heart tissue, rat heart tissue |
Positive IHC detected in | human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 3 publications below |
Product Information
27708-1-AP targets TMEM85 in WB, IHC, ELISA applications and shows reactivity with Human, Mouse, rat samples.
Tested Reactivity | Human, Mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26785 Product name: Recombinant human TMEM85 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-70 aa of BC002583 Sequence: MTAQGGLVANRGRRFKWAIELSGPGGGSRGRSDRGSGQGDSLYPVGYLDKQVPDTSVQETDRILVEKRCW Predict reactive species |
Full Name | transmembrane protein 85 |
Observed Molecular Weight | 20 kDa |
GenBank Accession Number | BC002583 |
Gene Symbol | TMEM85 |
Gene ID (NCBI) | 51234 |
RRID | AB_2880950 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q5J8M3 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TMEM85 antibody 27708-1-AP | Download protocol |
IHC protocol for TMEM85 antibody 27708-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
J Cell Biol A selectivity filter in the ER membrane protein complex limits protein misinsertion at the ER | ||
bioRxiv Role of a holo-insertase complex in the biogenesis of biophysically diverse ER membrane proteins |