TMEM9 Polyclonal antibody

• 

  WB analysis of LNCaP using 19918-1-AP

  LNCaP cells were subjected to SDS PAGE followed by western blot with 19918-1-AP (TMEM9 antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours.

• 

  WB analysis of LNCaP using 19918-1-AP

  LNCaP cells were subjected to SDS PAGE followed by western blot with 19918-1-AP (TMEM9 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

TMEM9 Polyclonal Antibody for WB, ELISA

Cat No. 19918-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

DERP4, PSEC0012, TMEM9, TMEM9A, transmembrane protein 9, UNQ631/PRO1248

---

Tested Applications

• Positive WB detected in: LNCaP cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below

Product Information

19918-1-AP targets TMEM9 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13831

  Product name: Recombinant human TMEM9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 111-183 aa of BC001106

  Sequence: LVDPLIRKPDAYTEQLHNEEENEDARSMAAAAASLGGPRANTVLERVEGAQQRWKLQVQEQRKTVFDRHKMLS

• Full Name: transmembrane protein 9
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC001106
• Gene Symbol: TMEM9
• Gene ID (NCBI): 252839
• RRID: AB_2878622
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P0T7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The function of TMEM9 remains largely unknown. TMEM9 belongs to the TMEM9 family, and may be involved in intracellular transport.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Biol Pharm Bull; Tumor-Promoting Properties of TMEM9A in Breast Cancer Progression via Activating the Wnt/β-Catenin Signaling Pathway; Authors - Jianchao He ; KD Validated