Tested Applications
Positive WB detected in | LNCaP cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:200-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 1 publications below |
Product Information
19918-1-AP targets TMEM9 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag13831 Product name: Recombinant human TMEM9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 111-183 aa of BC001106 Sequence: LVDPLIRKPDAYTEQLHNEEENEDARSMAAAAASLGGPRANTVLERVEGAQQRWKLQVQEQRKTVFDRHKMLS Predict reactive species |
Full Name | transmembrane protein 9 |
Calculated Molecular Weight | 21 kDa |
Observed Molecular Weight | 23 kDa |
GenBank Accession Number | BC001106 |
Gene Symbol | TMEM9 |
Gene ID (NCBI) | 252839 |
RRID | AB_2878622 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9P0T7 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The function of TMEM9 remains largely unknown. TMEM9 belongs to the TMEM9 family, and may be involved in intracellular transport.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TMEM9 antibody 19918-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |