Tested Applications
Positive WB detected in | Caco-2 cells, HEK-293T cells, HeLa cells, mouse testis tissue |
Positive IHC detected in | mouse testis tissue, human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 6 publications below |
IHC | See 1 publications below |
Product Information
26444-1-AP targets TMEM97 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag23917 Product name: Recombinant human TMEM97 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-69 aa of BC045655 Sequence: MTTLIPILSTFLFEDFSKASGFKGQRPETLHERLTLVSVYAPYLLIPFILLIFMLRSPYYKYEEKRKKK Predict reactive species |
Full Name | transmembrane protein 97 |
Observed Molecular Weight | 19-20 kDa |
GenBank Accession Number | BC045655 |
Gene Symbol | TMEM97 |
Gene ID (NCBI) | 27346 |
RRID | AB_2880515 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q5BJF2 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TMEM97 antibody 26444-1-AP | Download protocol |
IHC protocol for TMEM97 antibody 26444-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nat Chem Biol A proteome-wide map of 20(S)-hydroxycholesterol interactors in cell membranes. | ||
ACS Chem Neurosci Sigma Receptor Ligands Are Potent Antiprion Compounds that Act Independently of Sigma Receptor Binding
| ||
J Bioenerg Biomembr Meningioma-associated protein 30 accelerates the proliferation and invasion of hepatocellular carcinoma by modulating Wnt/GSK-3β/β-catenin signaling. | ||
Life Sci Alliance The ADAM17 sheddase complex regulator iTAP/Frmd8 modulates inflammation and tumor growth | ||
Cell Biosci PABPN1 regulates mRNA alternative polyadenylation to inhibit bladder cancer progression |