TMEM97 Polyclonal antibody

• 

  WB analysis using 26444-1-AP

  Caco-2 cells were subjected to SDS PAGE followed by western blot with 26444-1-AP (TMEM97 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 26444-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26444-1-AP (TMEM97 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse testis using 26444-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 26444-1-AP (TMEM97 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 26444-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 26444-1-AP (TMEM97 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 26444-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 26444-1-AP (TMEM97 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 26444-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 26444-1-AP (TMEM97 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of Caco-2 using 26444-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed Caco-2 cells using TMEM97 antibody (26444-1-AP) at dilution of 1:300 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• Featured Product
• KD/KO Validated

TMEM97 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 26444-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

MAC30, Protein MAC30, S2R, Sigma2 receptor, Sigma-2 receptor

---

Tested Applications

• Positive WB detected in: Caco-2 cells, HEK-293T cells, HeLa cells, mouse testis tissue
• Positive IHC detected in: mouse testis tissue, human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: Caco-2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:150-1:600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 6 publications below
• IHC: See 1 publications below

Product Information

26444-1-AP targets TMEM97 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23917

  Product name: Recombinant human TMEM97 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-69 aa of BC045655

  Sequence: MTTLIPILSTFLFEDFSKASGFKGQRPETLHERLTLVSVYAPYLLIPFILLIFMLRSPYYKYEEKRKKK

• Full Name: transmembrane protein 97
• Observed Molecular Weight: 19-20 kDa
• GenBank Accession Number: BC045655
• Gene Symbol: TMEM97
• Gene ID (NCBI): 27346
• RRID: AB_2880515
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q5BJF2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Chem Biol; A proteome-wide map of 20(S)-hydroxycholesterol interactors in cell membranes.; Authors - Yu-Shiuan Cheng
mouse	WB	ACS Chem Neurosci; Sigma Receptor Ligands Are Potent Antiprion Compounds that Act Independently of Sigma Receptor Binding; Authors - Robert C C Mercer ; KD Validated
mouse,human		Cell Signal; TMEM97 ablation aggravates oxidant-induced retinal degeneration.; Authors - Hongtao Shen ; KO Validated
human	WB	J Bioenerg Biomembr; Meningioma-associated protein 30 accelerates the proliferation and invasion of hepatocellular carcinoma by modulating Wnt/GSK-3β/β-catenin signaling.; Authors - Yu Zhang
human	WB,IHC	Cell Biosci; PABPN1 regulates mRNA alternative polyadenylation to inhibit bladder cancer progression; Authors - Liang Chen
mouse	WB	bioRxiv; Sigma receptor ligands are potent anti-prion compounds that act independently of sigma receptor binding; Authors - Robert C C Mercer