TMEM9B Polyclonal antibody

• 

  WB analysis of rat liver using 24331-1-AP

  rat liver tissue were subjected to SDS PAGE followed by western blot with 24331-1-AP (TMEM9B Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse colon using 24331-1-AP

  mouse colon tissue were subjected to SDS PAGE followed by western blot with 24331-1-AP (TMEM9B Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 24331-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer slide using 24331-1-AP (TMEM9B Antibody) at dilution of 1:50.

• 

  IHC staining of human colon cancer using 24331-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer slide using 24331-1-AP (TMEM9B Antibody) at dilution of 1:50.

TMEM9B Polyclonal Antibody for WB, IHC, ELISA

Cat No. 24331-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, rat, mouse

Applications

WB, IHC, ELISA

Synonyms

C11orf15, TMEM9 domain family, member B, TMEM9B, Transmembrane protein 9B

---

Tested Applications

• Positive WB detected in: rat liver tissue, mouse colon tissue
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24331-1-AP targets TMEM9B in WB, IHC, ELISA applications and shows reactivity with human, rat, mouse samples.

• Tested Reactivity: human, rat, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19383

  Product name: Recombinant human TMEM9B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 80-172 aa of BC040124

  Sequence: PDVEAYCLRCECKYEERSSVTIKVTIIIYLSILGLLLLYMVYLTLVEPILKRRLFGHAQLIQSDDDIGDHQPFANAHDVLARSRSRANVLNKV

• Full Name: TMEM9 domain family, member B
• Calculated Molecular Weight: 198 aa, 23 kDa
• Observed Molecular Weight: 23 kDa, 35 kDa
• GenBank Accession Number: BC040124
• Gene Symbol: TMEM9B
• Gene ID (NCBI): 56674
• RRID: AB_2879497
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NQ34
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TMEM9B, also termed as Transmembrane protein 9B encodes a 198 amino-acidprotein that contains an N-terminal signal peptide, a single transmembrane region, three potential N-glycosylation sites, and three conserved cys-rich domains in the N-terminus. There is a dimer form of TMEM9B protein (PMID: 12359240). TMEM9B mRNA is expressed in a wide range of tissues and cells. TMEM9B is a lysosomal transmembrane protein that regulates the activity of inflammatory signaling pathways.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse		Nat Commun; Endosomal chloride/proton exchangers need inhibitory TMEM9 β-subunits for regulation and prevention of disease-causing overactivity; Authors - Rosa Planells-Cases