Tested Applications
Positive WB detected in | rat liver tissue, mouse colon tissue |
Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
24331-1-AP targets TMEM9B in WB, IHC, ELISA applications and shows reactivity with human, rat, mouse samples.
Tested Reactivity | human, rat, mouse |
Cited Reactivity | mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag19383 Product name: Recombinant human TMEM9B protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 80-172 aa of BC040124 Sequence: PDVEAYCLRCECKYEERSSVTIKVTIIIYLSILGLLLLYMVYLTLVEPILKRRLFGHAQLIQSDDDIGDHQPFANAHDVLARSRSRANVLNKV Predict reactive species |
Full Name | TMEM9 domain family, member B |
Calculated Molecular Weight | 198 aa, 23 kDa |
Observed Molecular Weight | 23 kDa, 35 kDa |
GenBank Accession Number | BC040124 |
Gene Symbol | TMEM9B |
Gene ID (NCBI) | 56674 |
RRID | AB_2879497 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9NQ34 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TMEM9B, also termed as Transmembrane protein 9B encodes a 198 amino-acidprotein that contains an N-terminal signal peptide, a single transmembrane region, three potential N-glycosylation sites, and three conserved cys-rich domains in the N-terminus. There is a dimer form of TMEM9B protein (PMID: 12359240). TMEM9B mRNA is expressed in a wide range of tissues and cells. TMEM9B is a lysosomal transmembrane protein that regulates the activity of inflammatory signaling pathways.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TMEM9B antibody 24331-1-AP | Download protocol |
IHC protocol for TMEM9B antibody 24331-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |