Product Information
25470-1-AP targets TMIE in ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag22068 Product name: Recombinant human TMIE protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 79-156 aa of BC126258 Sequence: NCRVPRTRKEIEARYLQRKAAKMYTDKLETVPPLNELTEVPGEDKKKKKKKKDSVDTVAIKVEEDEKNEAKKKKGEK Predict reactive species |
Full Name | transmembrane inner ear |
Calculated Molecular Weight | 156 aa, 17 kDa |
GenBank Accession Number | BC126258 |
Gene Symbol | TMIE |
Gene ID (NCBI) | 259236 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8NEW7 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |