TMIGD1 Polyclonal antibody

• 

  WB analysis of mouse kidney using 27174-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 27174-1-AP (TMIGD1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 27174-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27174-1-AP (TMIGD1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse kidney using 27174-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 27174-1-AP (TMIGD1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse kidney using 27174-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 27174-1-AP (TMIGD1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 27174-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 27174-1-AP (TMIGD1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 27174-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 27174-1-AP (TMIGD1 antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human colon using 27174-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 27174-1-AP (TMIGD1 antibody) at dilution of 1:200 (under 40x lens).

• 

  IF Staining of rat small intestine using 27174-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat small intestine tissue using TMIGD1 antibody (27174-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse small intestine using 27174-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse small intestine tissue using TMIGD1 antibody (27174-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TMIGD1 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 27174-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF-P, ELISA

Synonyms

TMIGD, Transmembrane and immunoglobulin domain-containing protein 1, UNQ9372/PRO34164

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, Daudi cells, HUVEC cells, Raji cells
• Positive IHC detected in: mouse kidney tissue, human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: rat small intestine tissue, mouse small intestine tissue

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

27174-1-AP targets TMIGD1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25691

  Product name: Recombinant human TMIGD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 133-207 aa of BC137201

  Sequence: VEEGSNVKLVCNVKANPQAQMMWYKNSSLLDLEKSRHQIQQTSESFQLSITKVEKPDNGTYSCIAKSSLKTESLD

• Full Name: transmembrane and immunoglobulin domain containing 1
• Calculated Molecular Weight: 262 aa, 29 kDa
• Observed Molecular Weight: 45 kDa, 29 kDa
• GenBank Accession Number: BC137201
• Gene Symbol: TMIGD1
• Gene ID (NCBI): 388364
• RRID: AB_2880786
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6UXZ0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TMIGD1 (Transmembrane and immunoglobulin domain containing 1) is involved in various cellular processes such as regulation of cell structure, cell-cell adhesion, and cellular movement. It protects cells from oxidative- and nutrient-deprivation-induced cell injury by stabilizing the transepithelial electric resistance and permeability of renal epithelial cells. TMIGD1 has a calculated molecular mass of 29 kDa, and can be detected as 45 kDa due to the N-glycosylation (PMID: 26342724).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB,IF	Sci Signal; Intestinal brush border formation requires a TMIGD1-based intermicrovillar adhesion complex; Authors - Christian Hartmann
human	WB,IHC	Int Immunopharmacol; Macrophage-derived exosomes promote intestinal mucosal barrier dysfunction in inflammatory bowel disease by regulating TMIGD1 via mircroRNA-223; Authors - Xin Chang