TMPRSS3 Polyclonal antibody, PBS Only

• 

  IHC staining of human skin cancer using 51149-1-AP (same clone as 51149-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 51149-1-AP (TMPRSS3 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 51149-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin cancer using 51149-1-AP (same clone as 51149-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 51149-1-AP (TMPRSS3 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 51149-1-PBS in a different storage buffer formulation.

TMPRSS3 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 51149-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

51149-1-PBS targets TMPRSS3 in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0443

  Product name: Recombinant human TMPRSS3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-500 aa of BC074846

  Sequence: MGENDPPAVEAPFSFRSLFGLDDLKISPVAPDADAVAAQILSLLPLKFFPIIVIGIIALILALAIGLGIHFDCSGKYRCRSSFKCIELIARCDGVSDCKDGEDEYRCVRVGGQNAVLQVFTAASWKTMCSDDWKGHYANVACAQLGFPSYVSSDNLRVSSLEGQFREEFVSIDHLLPDDKVTALHHSVYVREGCASGHVVTLQCTACGHRRGYSSRIVGGNMSLLSQWPWQASLQFQGYHLCGGSVITPLWIITAAHCVYDLYLPKSWTIQVGLVSLLDNPAPSHLVEKIVYHSKYKPKRLGNDIALMKLAGPLTFNEMIQPVCLPNSEENFPDGKVCWTSGWGATEDGGDASPVLNHAAVPLISNKICNHRDVYGGIISPSMLCAGYLTGGVDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVNKPGVYTRVTSFLDWIHEQMERDLKT

• Full Name: transmembrane protease, serine 3
• Calculated Molecular Weight: 453 aa, 49 kDa
• GenBank Accession Number: BC074846
• Gene Symbol: TMPRSS3
• Gene ID (NCBI): 64699
• RRID: AB_2881253
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P57727
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.