TMPRSS3 Polyclonal antibody

• 

  IHC staining of human skin cancer using 51149-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 51149-1-AP (TMPRSS3 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human skin cancer using 51149-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 51149-1-AP (TMPRSS3 Antibody) at dilution of 1:50 (under 40x lens).

TMPRSS3 Polyclonal Antibody for IHC, ELISA

Cat No. 51149-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, ELISA

Synonyms

DFNB10, DFNB8, ECHOS1, Serine protease TADG 12, TADG12, TMPRSS3

---

Tested Applications

• Positive IHC detected in: human skin cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

51149-1-AP targets TMPRSS3 in IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0443

  Product name: Recombinant human TMPRSS3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-500 aa of BC074846

  Sequence: MGENDPPAVEAPFSFRSLFGLDDLKISPVAPDADAVAAQILSLLPLKFFPIIVIGIIALILALAIGLGIHFDCSGKYRCRSSFKCIELIARCDGVSDCKDGEDEYRCVRVGGQNAVLQVFTAASWKTMCSDDWKGHYANVACAQLGFPSYVSSDNLRVSSLEGQFREEFVSIDHLLPDDKVTALHHSVYVREGCASGHVVTLQCTACGHRRGYSSRIVGGNMSLLSQWPWQASLQFQGYHLCGGSVITPLWIITAAHCVYDLYLPKSWTIQVGLVSLLDNPAPSHLVEKIVYHSKYKPKRLGNDIALMKLAGPLTFNEMIQPVCLPNSEENFPDGKVCWTSGWGATEDGGDASPVLNHAAVPLISNKICNHRDVYGGIISPSMLCAGYLTGGVDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVNKPGVYTRVTSFLDWIHEQMERDLKT

• Full Name: transmembrane protease, serine 3
• Calculated Molecular Weight: 453 aa, 49 kDa
• GenBank Accession Number: BC074846
• Gene Symbol: TMPRSS3
• Gene ID (NCBI): 64699
• RRID: AB_2881253
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P57727
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.