Tested Applications
| Positive WB detected in | HEK-293T cells, mouse brain tissue, HeLa cells, Jurkat cells |
| Positive IHC detected in | human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 7 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
Product Information
27489-1-AP targets TMX1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26595 Product name: Recombinant human TMX1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 202-280 aa of BC036460 Sequence: VADCLCPSKRRRPQPYPYPSKKLLSESAQPLKKVEEEQEADEEDVSEEEAESKEGTNKDFPQNAIRQRSLGPSLATDKS Predict reactive species |
| Full Name | thioredoxin-related transmembrane protein 1 |
| Calculated Molecular Weight | 32 kDa |
| Observed Molecular Weight | 31 kDa |
| GenBank Accession Number | BC036460 |
| Gene Symbol | TMX1 |
| Gene ID (NCBI) | 81542 |
| RRID | AB_2880886 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H3N1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TMX1, one of the few transmembrane members of the family, is the first vascular thiol isomerase with antithrombotic function. It forms functional complexes with the ER lectin calnexin and preferentially intervenes during maturation of cysteine-containing, membrane-associated proteins while ignoring the same cysteine-containing ectodomains if not anchored at the ER membrane. As such, TMX1 is the first example of a topology-specific client protein redox catalyst in living cells(PMID: 30655304). Covalent modification with AMS increases the molecular mass of originally oxidized species by ~0.5 kDa per thiol group, which allows enhanced separation from the reduced form in electrophoresis(PMID: 29123984). TMX1 has 2 bands produces by redox with the MW of 30-32 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for TMX1 antibody 27489-1-AP | Download protocol |
| WB protocol for TMX1 antibody 27489-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Redox Biol Protein palmitoylation-mediated palmitic acid sensing causes blood-testis barrier damage via inducing ER stress. | ||
Biochem J Opposing regulation of endoplasmic reticulum retention under stress by ERp44 and PDIA6 | ||
Sci Rep Thioredoxin related transmembrane protein 1acts as a prognostic indictor and promotes proliferation and TMZ resistance of lower-grade glioma
| ||
Arch Toxicol An integrative multi-omics study to identify candidate DNA methylation biomarkers associated with gastric cancer prognosis | ||
J Biol Chem Competition for cysteine acylation by C16:0 and C18:0 derived lipids is a global phenomenon in the proteome | ||
J Thromb Haemost A novel role for thioredoxin-related transmembrane protein TMX4 in platelet activation and thrombus formation |







