TMX1 Polyclonal antibody, PBS Only

• 

  WB analysis using 27489-1-AP (same clone as 27489-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27489-1-AP (TMX1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27489-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 27489-1-AP (same clone as 27489-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 27489-1-AP (TMX1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27489-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 27489-1-AP (same clone as 27489-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 27489-1-AP (TMX1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27489-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 27489-1-AP (same clone as 27489-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 27489-1-AP (TMX1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27489-1-PBS in a different storage buffer formulation.

TMX1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27489-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Thioredoxin-related transmembrane protein 1, Thioredoxin domain-containing protein 1, PSEC0085, Protein disulfide-isomerase TMX1, PDIA11

---

Product Information

27489-1-PBS targets TMX1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26595

  Product name: Recombinant human TMX1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 202-280 aa of BC036460

  Sequence: VADCLCPSKRRRPQPYPYPSKKLLSESAQPLKKVEEEQEADEEDVSEEEAESKEGTNKDFPQNAIRQRSLGPSLATDKS

• Full Name: thioredoxin-related transmembrane protein 1
• Calculated Molecular Weight: 32 kDa
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: BC036460
• Gene Symbol: TMX1
• Gene ID (NCBI): 81542
• RRID: AB_2880886
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H3N1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TMX1, one of the few transmembrane members of the family, is the first vascular thiol isomerase with antithrombotic function. It forms functional complexes with the ER lectin calnexin and preferentially intervenes during maturation of cysteine-containing, membrane-associated proteins while ignoring the same cysteine-containing ectodomains if not anchored at the ER membrane. As such, TMX1 is the first example of a topology-specific client protein redox catalyst in living cells(PMID: 30655304). Covalent modification with AMS increases the molecular mass of originally oxidized species by ~0.5 kDa per thiol group, which allows enhanced separation from the reduced form in electrophoresis(PMID: 29123984). TMX1 has 2 bands produces by redox with the MW of 30-32 kDa.