Filter: AllWBIHCIF

WB analysis using 67710-1-Ig (same clone as 67710-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 67710-1-Ig (TNC/Tenascin-C antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67710-1-PBS in a different storage buffer formulation.
WB analysis of rat cerebellum using 67710-1-Ig (same clone as 67710-1-PBS)
rat cerebellum tissue were subjected to SDS PAGE followed by western blot with 67710-1-Ig (TNC/Tenascin-C antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67710-1-PBS in a different storage buffer formulation.
WB analysis of HEK-293 using 67710-1-Ig (same clone as 67710-1-PBS)
HEK-293 cells were subjected to SDS PAGE followed by western blot with 67710-1-Ig (TNC/Tenascin-C antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67710-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 67710-1-Ig (same clone as 67710-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67710-1-Ig (TNC/Tenascin-C antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67710-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 67710-1-Ig (same clone as 67710-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67710-1-Ig (TNC/Tenascin-C antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67710-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 67710-1-Ig (same clone as 67710-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67710-1-Ig (TNC/Tenascin-C antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67710-1-PBS in a different storage buffer formulation.
IHC staining of human liver cancer using 67710-1-Ig (same clone as 67710-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 67710-1-Ig (TNC/Tenascin-C antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67710-1-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 67710-1-Ig (same clone as 67710-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67710-1-Ig (TNC/Tenascin-C antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67710-1-PBS in a different storage buffer formulation.
IHC staining of human lung cancer using 67710-1-Ig (same clone as 67710-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67710-1-Ig (TNC/Tenascin-C antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67710-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 67710-1-Ig (same clone as 67710-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67710-1-Ig (TNC/Tenascin-C antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67710-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 67710-1-Ig (same clone as 67710-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67710-1-Ig (TNC/Tenascin-C antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67710-1-PBS in a different storage buffer formulation.
IHC staining of rat brain using 67710-1-Ig (same clone as 67710-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 67710-1-Ig (TNC/Tenascin-C antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67710-1-PBS in a different storage buffer formulation.
IHC staining of rat brain using 67710-1-Ig (same clone as 67710-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 67710-1-Ig (TNC/Tenascin-C antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67710-1-PBS in a different storage buffer formulation.
IF Staining of rat brain using 67710-1-Ig (same clone as 67710-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat brain tissue using TNC/Tenascin-C antibody (67710-1-Ig, Clone: 1F7G8 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67710-1-PBS in a different storage buffer formulation.

TNC/Tenascin-C Monoclonal antibody, PBS Only

TNC/Tenascin-C Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67710-1-PBS

Clone No.1F7G8

Review Product

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Cytotactin, GMEM, GP 150 225, Hexabrachion, HXB, JI, Myotendinous antigen, Neuronectin, Tenascin, tenascin C, TN, TN C, TNC

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

67710-1-PBS targets TNC/Tenascin-C in WB, IHC, Indirect ELISA applications and shows reactivity with Human, Mouse, Rat samples.

Tested Reactivity	Human, Mouse, Rat
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag21412 Product name: Recombinant human TNC protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1852-2201 aa of BC151843 Sequence: YALTDLEPATEYTLRIFAEKGPQKSSTITAKFTTDLDSPRDLTATEVQSETALLTWRPPRASVTGYLLVYESVDGTVKEVIVGPDTTSYSLADLSPSTHYTAKIQALNGPLRSNMIQTIFTTIGLLYPFPKDCSQAMLNGDTTSGLYTIYLNGDKAEALEVFCDMTSDGGGWIVFLRRKNGRENFYQNWKAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYKLKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMGRYGDNNHSQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLEGRRKRA Predict reactive species
Full Name	tenascin C
Calculated Molecular Weight	2201 aa, 241 kDa
Observed Molecular Weight	260 kDa
GenBank Accession Number	BC151843
Gene Symbol	Tenascin C
Gene ID (NCBI)	3371
RRID	AB_2882900
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein G purification
UNIPROT ID	P24821
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Tenascin-C (TNC) is a large hexameric extracellular matrix glycoprotein of the tenascin family (PMID: 21818551). It is a multimodular protein containing multiple epidermal growth factor (EGF)-like repeats and fibronectin type III (FN III) domains (PMID: 1719530). Tenascin-C is highly expressed during embryonic development, particularly in the developing central nervous system, around motile cells and at epithelial-mesenchymal interaction sites (PMID: 25738825). In adult tissues, the expression and the distribution of TNC are typically limited under normal physiological conditions. It is upregulated during injury, inflammation, regeneration, and cancer (PMID: 7694605; 25120494). Tenascin-C is a diverse protein that can produce different functions including regulating cell adhesion, migration and proliferation.