Tested Applications
| Positive WB detected in | rat brain tissue, HEK-293 cells, rat cerebellum tissue, mouse brain tissue |
| Positive IHC detected in | human breast cancer tissue, human liver cancer tissue, human lung cancer tissue, mouse brain tissue, rat brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67710-1-Ig targets TNC/Tenascin-C in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21412 Product name: Recombinant human TNC protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1852-2201 aa of BC151843 Sequence: YALTDLEPATEYTLRIFAEKGPQKSSTITAKFTTDLDSPRDLTATEVQSETALLTWRPPRASVTGYLLVYESVDGTVKEVIVGPDTTSYSLADLSPSTHYTAKIQALNGPLRSNMIQTIFTTIGLLYPFPKDCSQAMLNGDTTSGLYTIYLNGDKAEALEVFCDMTSDGGGWIVFLRRKNGRENFYQNWKAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYKLKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMGRYGDNNHSQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLEGRRKRA Predict reactive species |
| Full Name | tenascin C |
| Calculated Molecular Weight | 2201 aa, 241 kDa |
| Observed Molecular Weight | 260 kDa |
| GenBank Accession Number | BC151843 |
| Gene Symbol | Tenascin C |
| Gene ID (NCBI) | 3371 |
| RRID | AB_2882900 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P24821 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Tenascin-C (TNC) is a large hexameric extracellular matrix glycoprotein of the tenascin family (PMID: 21818551). It is a multimodular protein containing multiple epidermal growth factor (EGF)-like repeats and fibronectin type III (FN III) domains (PMID: 1719530). Tenascin-C is highly expressed during embryonic development, particularly in the developing central nervous system, around motile cells and at epithelial-mesenchymal interaction sites (PMID: 25738825). In adult tissues, the expression and the distribution of TNC are typically limited under normal physiological conditions. It is upregulated during injury, inflammation, regeneration, and cancer (PMID: 7694605; 25120494). Tenascin-C is a diverse protein that can produce different functions including regulating cell adhesion, migration and proliferation.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TNC/Tenascin-C antibody 67710-1-Ig | Download protocol |
| IHC protocol for TNC/Tenascin-C antibody 67710-1-Ig | Download protocol |
| WB protocol for TNC/Tenascin-C antibody 67710-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Tenascin-C antibody (Cat# 67710-1-Ig) has 26 citations across journals including Nature Communications, Advanced Materials, Acta Biomaterialia, Cell Death & Disease, Arthritis & Rheumatology, and Journal of Investigative Dermatology. Research fields span tendon regeneration, skin fibrosis and scleroderma, cancer (glioblastoma, breast cancer, osteosarcoma), wound healing, neuroinflammation, diabetic complications, psoriasis, asthma, and spinal cord injury.
| Species | Application | Title |
|---|---|---|
Adv Mater Piezoelectric Injectable Anti-Adhesive Hydrogel to Promote Endogenous Healing of Tendon Injuries | ||
Nat Commun Tenascin C(+) myofibroblasts exacerbate vascular neointimal hyperplasia by propagation of nerve-macrophage interactions in mice.
| ||
J Nanobiotechnology 3D-printed hydrogel particles containing PRP laden with TDSCs promote tendon repair in a rat model of tendinopathy | ||
Genes Dis Engrailed-1 inactivation leads to scarless skin wound healing through extracellular matrix remodeling | ||
Cell Rep Med A biomimetic hybrid membrane vesicle nanoplatform attenuates tendinopathy through neuroinflammation modulation and tendon regeneration. | ||
Cell Death Dis CEBPD is a master transcriptional factor for hypoxia regulated proteins in glioblastoma and augments hypoxia induced invasion through extracellular matrix-integrin mediated EGFR/PI3K pathway |
Reviews
What customers say
All five reviews are 5-star ratings. Users consistently praise this Tenascin-C antibody for its excellent Western Blot performance, with successful use at dilutions of 1:1000–1:2000. Several reviewers also confirm reliable results in Immunohistochemistry and Immunofluorescence. The antibody has been validated on colon cancer tissue, CRC cells, mouse colon tissue, and Caco2 cells. Overall, customers describe it as a "very good" and "great" antibody that works well across multiple applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Sai Sindhura (Verified Customer) (08-19-2026) | Tenascin works very well for western
|
Iram (Verified Customer) (03-23-2026) | Very good antibody
|
Sai Sindhura (Verified Customer) (03-23-2026) | Tenascin-c is a good antibody
|
Iram (Verified Customer) (12-19-2025) | Works well for WB
|
Balawant (Verified Customer) (12-02-2022) | This antibody is great for western blot as well as for Immunofluorescence.
|
