TNC/Tenascin-C Monoclonal antibody

TNC/Tenascin-C Monoclonal Antibody for WB, IHC, ELISA
Cat No. 67710-1-Ig
Clone No.1F7G8

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat and More (3)

Applications

WB, IHC, IF, ELISA

Cytotactin, GMEM, GP 150 225, Hexabrachion, HXB, JI, Myotendinous antigen, Neuronectin, Tenascin, tenascin C, TN, TN C, TNC

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inrat brain tissue, HEK-293 cells, rat cerebellum tissue, mouse brain tissue
Positive IHC detected inhuman breast cancer tissue, human liver cancer tissue, human lung cancer tissue, mouse brain tissue, rat brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67710-1-Ig targets TNC/Tenascin-C in WB, IHC, IF, ELISA applications and shows reactivity with Human, Mouse, Rat samples.

Tested Reactivity Human, Mouse, Rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag21412

Product name: Recombinant human TNC protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1852-2201 aa of BC151843

Sequence: YALTDLEPATEYTLRIFAEKGPQKSSTITAKFTTDLDSPRDLTATEVQSETALLTWRPPRASVTGYLLVYESVDGTVKEVIVGPDTTSYSLADLSPSTHYTAKIQALNGPLRSNMIQTIFTTIGLLYPFPKDCSQAMLNGDTTSGLYTIYLNGDKAEALEVFCDMTSDGGGWIVFLRRKNGRENFYQNWKAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYKLKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMGRYGDNNHSQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLEGRRKRA

Predict reactive species
Full Name tenascin C
Calculated Molecular Weight 2201 aa, 241 kDa
Observed Molecular Weight260 kDa
GenBank Accession NumberBC151843
Gene Symbol Tenascin C
Gene ID (NCBI) 3371
RRIDAB_2882900
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP24821
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Tenascin-C (TNC) is a large hexameric extracellular matrix glycoprotein of the tenascin family (PMID: 21818551). It is a multimodular protein containing multiple epidermal growth factor (EGF)-like repeats and fibronectin type III (FN III) domains (PMID: 1719530). Tenascin-C is highly expressed during embryonic development, particularly in the developing central nervous system, around motile cells and at epithelial-mesenchymal interaction sites (PMID: 25738825). In adult tissues, the expression and the distribution of TNC are typically limited under normal physiological conditions. It is upregulated during injury, inflammation, regeneration, and cancer (PMID: 7694605; 25120494). Tenascin-C is a diverse protein that can produce different functions including regulating cell adhesion, migration and proliferation.

Protocols

Product Specific Protocols
IHC protocol for TNC/Tenascin-C antibody 67710-1-IgDownload protocol
WB protocol for TNC/Tenascin-C antibody 67710-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
ratWB,IHC

Oxid Med Cell Longev

Eugenol-Preconditioned Mesenchymal Stem Cell-Derived Extracellular Vesicles Promote Antioxidant Capacity of Tendon Stem Cells In Vitro and In Vivo.

Authors - Xiangze Li
ratWB,IF

Acta Biomater

Rejuvenation of tendon stem/progenitor cells for functional tendon regeneration through platelet-derived exosomes loaded with recombinant Yap1

Authors - Jinwei Lu
mouseIHC

Front Endocrinol (Lausanne)

Identification of diagnostic markers related to oxidative stress and inflammatory response in diabetic kidney disease by machine learning algorithms: Evidence from human transcriptomic data and mouse experiments

Authors - Ming Zhong
humanWB

Cell Death Dis

CEBPD is a master transcriptional factor for hypoxia regulated proteins in glioblastoma and augments hypoxia induced invasion through extracellular matrix-integrin mediated EGFR/PI3K pathway

Authors - Xing-Gang Mao
mouseWB

Mol Biotechnol

NT-3 Combined with TGF-β Signaling Pathway Enhance the Repair of Spinal Cord Injury by Inhibiting Glial Scar Formation and Promoting Axonal Regeneration

Authors - Taibang Chen
ratIF

J Nanobiotechnology

3D-printed hydrogel particles containing PRP laden with TDSCs promote tendon repair in a rat model of tendinopathy

Authors - Congsun Li

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Balawant (Verified Customer) (12-02-2022)

This antibody is great for western blot as well as for Immunofluorescence.

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1:1000 (WB) and 1:500 (IF)
  • Cell Tissue Type: Colon Tissue of mice and caco2 cell
Loading...
||
New chat Able
正在加载,请稍候...