Product Information
67737-1-PBS targets TNFAIP8 in WB, Indirect ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8805 Product name: Recombinant human TNFAIP8 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-198 aa of BC007014 Sequence: MHSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI Predict reactive species |
| Full Name | tumor necrosis factor, alpha-induced protein 8 |
| Calculated Molecular Weight | 198 aa, 23 kDa |
| Observed Molecular Weight | 19-21 kDa |
| GenBank Accession Number | BC007014 |
| Gene Symbol | TNFAIP8 |
| Gene ID (NCBI) | 25816 |
| RRID | AB_2918506 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | O95379 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
TNFAIP8 (tumor necrosis factor, alpha-induced protein 8), also called SCC-S2/GG2-1/NDED, is associated with enhanced cell survival and inhibition of apoptosis. The induction of TNFAIP8 by TNF depends on the activation of NFκB. TNFAIP8 suppresses the TNF-mediated apoptosis by inhibiting caspase-8 activity but not the processing of procaspase-8, subsequently resulting in inhibition of BID cleavage and caspase-3 activation. TNFAIP8 is expressed in adult spleen, lymph node, thymus, thyroid, bone marrow, and placenta, and in fetal liver, lung, and kidney at high levels, also expressed in various tumor tissues and all cancer cell lines tested.

