DcR1/TNFRSF10C Polyclonal antibody

DcR1/TNFRSF10C Polyclonal Antibody for WB, ELISA
Cat No. 24622-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

CD263, DCR1, Decoy receptor 1, LIT, Lymphocyte inhibitor of TRAIL, TNFRSF10C, TRAIL R3, TRAIL receptor 3, TRAILR3, TRID

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman peripheral blood leukocyte

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

24622-1-AP targets DcR1/TNFRSF10C in WB, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18399

Product name: Recombinant human TNFRSF10C protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 125-259 aa of BC125041

Sequence: CRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPASSHYLSCTIVGIIVLIVLLIVFV

Predict reactive species
Full Name tumor necrosis factor receptor superfamily, member 10c, decoy without an intracellular domain
Calculated Molecular Weight 259 aa, 27 kDa
Observed Molecular Weight60 kDa
GenBank Accession NumberBC125041
Gene Symbol DcR1
Gene ID (NCBI) 8794
RRIDAB_3085741
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO14798
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Decoy receptor 1 (DcR1), also known as TNFRSF10C, CD263, TRAIL-R3, or TRID, is a member of the TNF-receptor superfamily. DcR1 is a receptor for the cytotoxic ligand TRAIL. In contrast to DR4/TRAIL-R1 and DR5/TRAIL-R2, DcR1 is a glycosylphosphatidylinositol (GPI)-linked membrane molecule that lacks a cytoplasmic region, including the death domain (PMID: 9314565; 9242611). DcR1 is not capable of inducing apoptosis and is thought to function as an antagonistic receptor that protects cells from TRAIL-induced apoptosis (PMID: 9242610). The apparent molecular weight of DcR1 is larger than the calculated molecular weight of 27 kDa, suggesting the presence of extensive post-translational modifications and/or unusual structural motifs (PMID: 9373179).

Protocols

Product Specific Protocols
WB protocol for DcR1/TNFRSF10C antibody 24622-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...