DcR1/TNFRSF10C Polyclonal antibody

• Home
• Products
• Primary Antibodies
• DcR1/TNFRSF10C Polyclonal antibody (24622-1-AP)

DcR1/TNFRSF10C Polyclonal Antibody for WB, ELISA

Cat No. 24622-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

CD263, DCR1, Decoy receptor 1, LIT, Lymphocyte inhibitor of TRAIL, TNFRSF10C, TRAIL R3, TRAIL receptor 3, TRAILR3, TRID

• 

  WB analysis of human peripheral blood leukocyte using 24622-1-AP

  human peripheral blood leukocytes were subjected to SDS PAGE followed by western blot with 24622-1-AP (DcR1/TNFRSF10C antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for DcR1/TNFRSF10C in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human peripheral blood leukocyte

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24622-1-AP targets DcR1/TNFRSF10C in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18399

  Product name: Recombinant human TNFRSF10C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 125-259 aa of BC125041

  Sequence: CRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPASSHYLSCTIVGIIVLIVLLIVFV

• Full Name: tumor necrosis factor receptor superfamily, member 10c, decoy without an intracellular domain
• Calculated Molecular Weight: 259 aa, 27 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC125041
• Gene Symbol: DcR1
• Gene ID (NCBI): 8794
• RRID: AB_3085741
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14798
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Decoy receptor 1 (DcR1), also known as TNFRSF10C, CD263, TRAIL-R3, or TRID, is a member of the TNF-receptor superfamily. DcR1 is a receptor for the cytotoxic ligand TRAIL. In contrast to DR4/TRAIL-R1 and DR5/TRAIL-R2, DcR1 is a glycosylphosphatidylinositol (GPI)-linked membrane molecule that lacks a cytoplasmic region, including the death domain (PMID: 9314565; 9242611). DcR1 is not capable of inducing apoptosis and is thought to function as an antagonistic receptor that protects cells from TRAIL-induced apoptosis (PMID: 9242610). The apparent molecular weight of DcR1 is larger than the calculated molecular weight of 27 kDa, suggesting the presence of extensive post-translational modifications and/or unusual structural motifs (PMID: 9373179).

Publications

What published studies show

The DcR1/TNFRSF10C Polyclonal antibody (Cat# 24622-1-AP) has 1 total citation. It appears in Frontiers in Oncology (IF 3.4), published in 2025. The cited study investigates the mechanism of Butein in cutaneous squamous cell carcinoma through regulation of the TWEAK-FN14 signaling pathway, placing this antibody in the research fields of oncology and tumor signaling.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Oncol; Mechanism of action of Butein in cutaneous squamous cell carcinoma through regulation of the TWEAK-FN14 signaling pathway.; Authors - Qinyi Dong