Product Information
84419-2-PBS targets BCMA/TNFRSF17 in Indirect ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Eg1812 Product name: Recombinant Human TNFRSF17 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 1-54 aa of BC058291 Sequence: MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA Predict reactive species |
Full Name | tumor necrosis factor receptor superfamily, member 17 |
Calculated Molecular Weight | 184 aa, 20 kDa |
GenBank Accession Number | BC058291 |
Gene Symbol | TNFRSF17 |
Gene ID (NCBI) | 608 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q02223 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |