Product Information
84419-5-PBS targets BCMA/TNFRSF17 in Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Eg1812 Product name: Recombinant Human BCMA/TNFRSF17 protein (rFc Tag) Source: mammalian cells-derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 1-54 aa of BC058291 Sequence: MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA Predict reactive species |
| Full Name | tumor necrosis factor receptor superfamily, member 17 |
| Calculated Molecular Weight | 184 aa, 20 kDa |
| GenBank Accession Number | BC058291 |
| Gene Symbol | TNFRSF17 |
| Gene ID (NCBI) | 608 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q02223 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
