Anti-Mouse TNFSF18 Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of mouse splenocytes using 98423-5-RR (same clone as 98423-5-PBS)

  1x10^6 mouse splenocytes were surface stained with 0.25 ug Anti-Mouse TNFSF18 Rabbit RecAb (98423-5-RR, Clone:242937B11), or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were then stained with CoraLite® Plus 647 Anti-Mouse CD45R (B220). Cells were not fixed. This data was developed using the same antibody clone with 98423-5-PBS in a different storage buffer formulation.

• 

  FC experiment of mouse splenocytes using 98423-5-RR (same clone as 98423-5-PBS)

  1x10^6 mouse splenocytes were surface stained with 0.25 ug Anti-Mouse Tnfsf18 Rabbit RecAb (98423-5-RR, Clone:242937B11) (red) and PE-Conjugated Goat Anti-Rabbit IgG(H+L), or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue). Cells were not fixed. This data was developed using the same antibody clone with 98423-5-PBS in a different storage buffer formulation.

TNFSF18 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98423-5-PBS

Clone No.242937B11

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

GITR ligand, GITRL, Glucocorticoid-induced TNF-related ligand, Tumor necrosis factor ligand superfamily member 18

---

Product Information

98423-5-PBS targets TNFSF18 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2850

  Product name: Recombinant Mouse TNFSF18 protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 47-173 aa of NM_183391.3

  Sequence: TAIESCMVKFELSSSKWHMTSPKPHCVNTTSDGKLKILQSGTYLIYGQVIPVDKKYIKDNAPFVVQIYKKNDVLQTLMNDFQILPIGGVYELHAGDNIYLKFNSKDHIQKTNTYWGIILMPDLPFIS

• Full Name: tumor necrosis factor (ligand) superfamily, member 18
• Calculated Molecular Weight: 20 kDa
• GenBank Accession Number: NM_183391.3
• Gene Symbol: Tnfsf18
• Gene ID (NCBI): 240873
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q7TS55
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TNFSF18 (Tumor Necrosis Factor Superfamily Member 18), also known as GITRL (Glucocorticoid-Induced TNF Receptor Ligand) or AITRL (Activation-Induced T Cell Receptor Ligand), is a cytokine belonging to the tumor necrosis factor (TNF) ligand family. TNFSF18 is broadly expressed in various tissues, including the gallbladder, brain, and other tissues. TNFSF18 is expressed on the surface of antigen-presenting cells (APCs) such as dendritic cells, macrophages, and B cells. It is also found in endothelial cells, which play a role in the interaction between T lymphocytes and endothelial cells.