TNNC2 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse skeletal muscle using 15875-1-AP (same clone as 15875-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15875-1-AP (TNNC2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15875-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat skeletal muscle using 15875-1-AP (same clone as 15875-1-PBS)

  rat skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15875-1-AP (TNNC2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15875-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skeletal muscle using 15875-1-AP (same clone as 15875-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 15875-1-AP (TNNC2 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 15875-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skeletal muscle using 15875-1-AP (same clone as 15875-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 15875-1-AP (TNNC2 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 15875-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 15875-1-AP (same clone as 15875-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 15875-1-AP (TNNC2 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15875-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse skeletal muscle using 15875-1-AP (same clone as 15875-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 15875-1-AP (TNNC2 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15875-1-PBS in a different storage buffer formulation.

TNNC2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 15875-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

15875-1-PBS targets TNNC2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8636

  Product name: Recombinant human TNNC2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-160 aa of BC005323

  Sequence: MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ

• Full Name: troponin C type 2 (fast)
• Calculated Molecular Weight: 160 aa, 18 kDa
• Observed Molecular Weight: 20-23 kDa
• GenBank Accession Number: BC005323
• Gene Symbol: TNNC2
• Gene ID (NCBI): 7125
• RRID: AB_2878194
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P02585
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.