TNNC2 Polyclonal antibody

• 

  WB analysis of mouse skeletal muscle using 15875-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15875-1-AP (TNNC2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat skeletal muscle using 15875-1-AP

  rat skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15875-1-AP (TNNC2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human skeletal muscle using 15875-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 15875-1-AP (TNNC2 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human skeletal muscle using 15875-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 15875-1-AP (TNNC2 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of mouse skeletal muscle using 15875-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 15875-1-AP (TNNC2 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skeletal muscle using 15875-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 15875-1-AP (TNNC2 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TNNC2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15875-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, IHC, ELISA

Synonyms

TNNC2, troponin C type 2 (fast), Troponin C, skeletal muscle

---

Tested Applications

• Positive WB detected in: mouse skeletal muscle tissue, rat skeletal muscle tissue
• Positive IHC detected in: human skeletal muscle tissue, mouse skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 1 publications below

Product Information

15875-1-AP targets TNNC2 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8636

  Product name: Recombinant human TNNC2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-160 aa of BC005323

  Sequence: MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ

• Full Name: troponin C type 2 (fast)
• Calculated Molecular Weight: 160 aa, 18 kDa
• Observed Molecular Weight: 20-23 kDa
• GenBank Accession Number: BC005323
• Gene Symbol: TNNC2
• Gene ID (NCBI): 7125
• RRID: AB_2878194
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P02585
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IF	Cell Rep; Transcriptional Dynamics of Hair-Bundle Morphogenesis Revealed with CellTrails.; Authors - Daniel C Ellwanger
human	WB	iScience; Integrative analysis reveals marker genes for intestinal mucosa barrier repairing in clinical patients; Authors - Xiao-Hu Zhao