Use Able AI chat for product recommendations

Tenascin-X Polyclonal antibody

Tenascin-X Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 13595-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Tenascin X, tenascin XB, TNXB, Hexabrachion like protein, Hexabrachion-like protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse liver tissue, HT-1080 cells, rat liver tissue
Positive IP detected inmouse liver tissue
Positive IHC detected inhuman kidney tissue, human heart tissue, human lung tissue, human breast cancer tissue, human liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13595-1-AP targets Tenascin-X in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4501

Product name: Recombinant human TNXB protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 321-673 aa of BC033740

Sequence: PGSAVDYPLHDLVLHTNYTATVRGLRGPNLTSPASITFTTGLEAPRDLEAKEVTPRTALLTWTEPPVRPAGYLLSFHTPGGQNQEILLPGGITSHQLLGLFPSTSYNARLQAMWGQSLLPPVSTSFTTGGLRIPFPRDCGEEMQNGAGASRTSTIFLNGNRERPLNVFCDMETDGGGWLVFQRRMDGQTDFWRDWEDYAHGFGNISGEFWLGNEALHSLTQAGDYSMRVDLRAGDEAVFAQYDSFHVDSAAEYYRLHLEGYHGTAGDSMSYHSGSVFSARDRDPNSLLISCAVSYRGAWWYRNCHYANLNGLYGSTVDHQGVSWYHWKGFEFSVPFTEMKLRPRNFRSPAGGG

Predict reactive species
Full Name tenascin XB
Calculated Molecular Weight 4289 aa, 464 kDa
Observed Molecular Weight 75 kDa, 140 kDa
GenBank Accession NumberBC033740
Gene Symbol TNXB
Gene ID (NCBI) 7148
RRIDAB_10644124
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP22105
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Tenascin-X (TNXB) is an extracellular matrix glycoprotein predominantly located in the outer reticular lamina of the basement membrane (BM) (PMID: 23768946). It interacts with many other ECM proteins and it accelerates collagen fibrillogenesis in vitro. TNXB plays a role in interactions between cell and ECM, antiadhesive effect, inhibiting cell migration, and in maintaining homeostasis of the extracellular matrix. Deficiency of TNXB has been associated with the connective tissue disorder Ehlers-Danlos syndrome. This antibody is raised against human TNXB and detects a band of about 75 kDa, which probably represents a proteolytic cleaved form of human TNXB (PMID: 17263730). But the serum form of tenascin-X is a 140-kD protein probably resulting from proteolytic cleavage or alternative splicing of tenascin-X(PMID: 16567571, 11642233).

Protocols

Product Specific Protocols
IHC protocol for Tenascin-X antibody 13595-1-APDownload protocol
IP protocol for Tenascin-X antibody 13595-1-APDownload protocol
WB protocol for Tenascin-X antibody 13595-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanWB,IHC,IF

J Am Soc Nephrol

TNXB mutations can cause vesicoureteral reflux.

Authors - Rasheed A Gbadegesin
humanIF

Matrix Biol

Proteome-wide and matrisome-specific atlas of the human ovary computes fertility biomarker candidates and open the way for precision oncofertility.

Authors - Emna Ouni
humanWB,IHC

World J Gastroenterol

Role of Tenascin-X in regulating TGF-β/Smad signaling pathway in pathogenesis of slow transit constipation.

Authors - Yi-Chao Zhang
mouseWB,IF

Arterioscler Thromb Vasc Biol

Loss of Smooth Muscle Tenascin-X Inhibits Vascular Remodeling Through Increased TGF-β Signaling

Authors - Guozheng Liang
humanIHC

Biol Direct

Comprehensive analysis of the causal risk factor from hypertension associated with prognosis and therapeutic response in renal cell carcinoma by multi-omics analysis and validation.

Authors - Wen-jin Chen
IHC

Elife

Aberrant methylation and expression of TNXB promote chondrocyte apoptosis and extracullar matrix degradation in hemophilic arthropathy via AKT signaling

Authors - Jiali Chen

Reviews

    4.5 out of 5
Add a review

2 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Mounika (Verified Customer) (01-08-2026)

Bands are bright, helped in completing our Research project

  • Applications: Western Blot, Immunohistochemistry, Immunofluorescence
  • Primary Antibody Dilution: 1:1000

Iram (Verified Customer) (09-04-2020)

Very sharp bands of TenascinX in western blotting

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000 for western
  • Cell Tissue Type: Human colon cancer
Loading...
||
New chat

Able

正在加载,请稍候...