Tested Applications
| Positive WB detected in | mouse liver tissue, HT-1080 cells, rat liver tissue |
| Positive IP detected in | mouse liver tissue |
| Positive IHC detected in | human kidney tissue, human heart tissue, human lung tissue, human breast cancer tissue, human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 4 publications below |
| IHC | See 4 publications below |
| IF | See 3 publications below |
Product Information
13595-1-AP targets Tenascin-X in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4501 Product name: Recombinant human TNXB protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 321-673 aa of BC033740 Sequence: PGSAVDYPLHDLVLHTNYTATVRGLRGPNLTSPASITFTTGLEAPRDLEAKEVTPRTALLTWTEPPVRPAGYLLSFHTPGGQNQEILLPGGITSHQLLGLFPSTSYNARLQAMWGQSLLPPVSTSFTTGGLRIPFPRDCGEEMQNGAGASRTSTIFLNGNRERPLNVFCDMETDGGGWLVFQRRMDGQTDFWRDWEDYAHGFGNISGEFWLGNEALHSLTQAGDYSMRVDLRAGDEAVFAQYDSFHVDSAAEYYRLHLEGYHGTAGDSMSYHSGSVFSARDRDPNSLLISCAVSYRGAWWYRNCHYANLNGLYGSTVDHQGVSWYHWKGFEFSVPFTEMKLRPRNFRSPAGGG Predict reactive species |
| Full Name | tenascin XB |
| Calculated Molecular Weight | 4289 aa, 464 kDa |
| Observed Molecular Weight | 75 kDa, 140 kDa |
| GenBank Accession Number | BC033740 |
| Gene Symbol | TNXB |
| Gene ID (NCBI) | 7148 |
| RRID | AB_10644124 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P22105 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Tenascin-X (TNXB) is an extracellular matrix glycoprotein predominantly located in the outer reticular lamina of the basement membrane (BM) (PMID: 23768946). It interacts with many other ECM proteins and it accelerates collagen fibrillogenesis in vitro. TNXB plays a role in interactions between cell and ECM, antiadhesive effect, inhibiting cell migration, and in maintaining homeostasis of the extracellular matrix. Deficiency of TNXB has been associated with the connective tissue disorder Ehlers-Danlos syndrome. This antibody is raised against human TNXB and detects a band of about 75 kDa, which probably represents a proteolytic cleaved form of human TNXB (PMID: 17263730). But the serum form of tenascin-X is a 140-kD protein probably resulting from proteolytic cleavage or alternative splicing of tenascin-X(PMID: 16567571, 11642233).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for Tenascin-X antibody 13595-1-AP | Download protocol |
| IP protocol for Tenascin-X antibody 13595-1-AP | Download protocol |
| WB protocol for Tenascin-X antibody 13595-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Matrix Biol Proteome-wide and matrisome-specific atlas of the human ovary computes fertility biomarker candidates and open the way for precision oncofertility. | ||
World J Gastroenterol Role of Tenascin-X in regulating TGF-β/Smad signaling pathway in pathogenesis of slow transit constipation. | ||
Mol Oncol Integrated proteome and phosphoproteome analysis of gastric adenocarcinoma reveals molecular signatures capable of stratifying patient outcome | ||
Arterioscler Thromb Vasc Biol Loss of Smooth Muscle Tenascin-X Inhibits Vascular Remodeling Through Increased TGF-β Signaling | ||
Elife Aberrant methylation and expression of TNXB promote chondrocyte apoptosis and extracullar matrix degradation in hemophilic arthropathy via AKT signaling |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Mounika (Verified Customer) (01-08-2026) | Bands are bright, helped in completing our Research project
|
FH Iram (Verified Customer) (09-04-2020) | Very sharp bands of TenascinX in western blotting
|

















