TOMM34 Polyclonal antibody

• 

  WB analysis using 12196-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12196-1-AP (TOMM34 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 12196-1-AP

  WB result of TOMM34 antibody (12196-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TOMM34 transfected HeLa cells.

• 

  IP experiment of HeLa using 12196-1-AP

  IP result of anti-TOMM34 (IP:12196-1-AP, 4ug; Detection:12196-1-AP 1:2000) with HeLa cells lysate 1320 ug.

• 

  IHC staining of human urothelial carcinoma using 12196-1-AP

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 12196-1-AP (TOMM34 antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human urothelial carcinoma using 12196-1-AP

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 12196-1-AP (TOMM34 antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

TOMM34 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 12196-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

hTom34, HTOM34P, TOM34, TOMM34, URCC3

---

Tested Applications

• Positive WB detected in: A375 cells, HeLa cells, PC-3 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human urothelial carcinoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:2000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below
• IHC: See 2 publications below

Product Information

12196-1-AP targets TOMM34 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2834

  Product name: Recombinant human TOMM34 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-309 aa of BC014907

  Sequence: MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDCIKDCTSALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHKKAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSSFADISNLLQIEPRNGPAQKLRQEVKQNLH

• Full Name: translocase of outer mitochondrial membrane 34
• Calculated Molecular Weight: 309 aa, 35 kDa
• Observed Molecular Weight: 31-35 kDa
• GenBank Accession Number: BC014907
• Gene Symbol: TOMM34
• Gene ID (NCBI): 10953
• RRID: AB_2240906
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15785
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IHC	Acta Neuropathol; The proteome of granulovacuolar degeneration and neurofibrillary tangles in Alzheimer's disease.; Authors - David C Hondius
mouse	WB	Free Radic Biol Med; Proteomic analysis of the glutathione-deficient LEGSKO mouse lens reveals activation of EMT signaling, loss of lens specific markers, and changes in stress response proteins.; Authors - Jeremy A Whitson
human	IHC	Pathol Oncol Res; High Expression of Tomm34 and Its Correlations With Clinicopathology in Oral Squamous Cell Carcinoma.; Authors - Min Cai
human	WB	J Oral Pathol Med; TOMM34 promotes cell proliferation, migration and invasion of OSCC and modulates mitochondrial function; Authors - Yunyi Huang ; KD Validated
Human		Front Aging Neurosci; Intraneuronal sortilin aggregation relative to granulovacuolar degeneration, tau pathogenesis and sorfra plaque formation in human hippocampal formation; Authors - Juan Jiang
human	WB	Cancer Res; A Genome-Wide Synthetic Lethal Screen Identifies Spermidine Synthase as a Target to Enhance Erdafitinib Efficacy in FGFR-Mutant Bladder Cancer; Authors - Yanchao Yu