• Featured Product
  • KD/KO Validated

TOMM34 Polyclonal antibody

TOMM34 Polyclonal Antibody for WB, IP, IHC, ELISA
Cat No. 12196-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

hTom34, HTOM34P, TOM34, TOMM34, URCC3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA375 cells, HeLa cells, PC-3 cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman urothelial carcinoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:2000-1:8000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12196-1-AP targets TOMM34 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2834

Product name: Recombinant human TOMM34 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-309 aa of BC014907

Sequence: MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDCIKDCTSALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHKKAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALKLDGKNVKAFYRRAQAHKALKDYKSSFADISNLLQIEPRNGPAQKLRQEVKQNLH

Predict reactive species
Full Name translocase of outer mitochondrial membrane 34
Calculated Molecular Weight 309 aa, 35 kDa
Observed Molecular Weight 31-35 kDa
GenBank Accession NumberBC014907
Gene Symbol TOMM34
Gene ID (NCBI) 10953
RRIDAB_2240906
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ15785
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for TOMM34 antibody 12196-1-APDownload protocol
IP protocol for TOMM34 antibody 12196-1-APDownload protocol
WB protocol for TOMM34 antibody 12196-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
IHC

Acta Neuropathol

The proteome of granulovacuolar degeneration and neurofibrillary tangles in Alzheimer's disease.

Authors - David C Hondius
mouseWB

Free Radic Biol Med

Proteomic analysis of the glutathione-deficient LEGSKO mouse lens reveals activation of EMT signaling, loss of lens specific markers, and changes in stress response proteins.

Authors - Jeremy A Whitson
humanIHC

Pathol Oncol Res

High Expression of Tomm34 and Its Correlations With Clinicopathology in Oral Squamous Cell Carcinoma.

Authors - Min Cai
humanWB

J Oral Pathol Med

TOMM34 promotes cell proliferation, migration and invasion of OSCC and modulates mitochondrial function

Authors - Yunyi Huang
  • KD Validated
Human

Front Aging Neurosci

Intraneuronal sortilin aggregation relative to granulovacuolar degeneration, tau pathogenesis and sorfra plaque formation in human hippocampal formation

Authors - Juan Jiang
humanWB

Cancer Res

A Genome-Wide Synthetic Lethal Screen Identifies Spermidine Synthase as a Target to Enhance Erdafitinib Efficacy in FGFR-Mutant Bladder Cancer

Authors - Yanchao Yu
Loading...
||
New chat Able
正在加载,请稍候...