Tested Applications
Positive IHC detected in | human gliomas tissue, human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 1 publications below |
IF | See 2 publications below |
Product Information
15071-1-AP targets TOMM7 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag7105 Product name: Recombinant human TOMM7 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-55 aa of BC001732 Sequence: MVKLSKEAKQRLQQLFKGSQFAIRWGFIPLVIYLGFKRGADPGMPEPTVLSLLWG Predict reactive species |
Full Name | translocase of outer mitochondrial membrane 7 homolog (yeast) |
Calculated Molecular Weight | 6 kDa |
Observed Molecular Weight | 6 kDa |
GenBank Accession Number | BC001732 |
Gene Symbol | TOMM7 |
Gene ID (NCBI) | 54543 |
RRID | AB_11232410 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9P0U1 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for TOMM7 antibody 15071-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Neurochem Int Inhibition of PTEN-induced kinase 1 autophosphorylation may assist in preventing epileptogenesis induced by pentylenetetrazol
| ||
Mol Biol Cell The receptor subunit Tom20 is dynamically associated with the TOM complex in mitochondria of human cells. | ||
Brain Res Bull Suppression of PINK1 autophosphorylation attenuates pilocarpine-induced seizures and neuronal injury in rats
|