TOMM7 Polyclonal antibody, PBS Only

• 

  IHC staining of human gliomas using 15071-1-AP (same clone as 15071-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas using 15071-1-AP (TOMM7 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 15071-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 15071-1-AP (same clone as 15071-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas using 15071-1-AP (TOMM7 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 15071-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 15071-1-AP (same clone as 15071-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas using 15071-1-AP (TOMM7 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 15071-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 15071-1-AP (same clone as 15071-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas using 15071-1-AP (TOMM7 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 15071-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 15071-1-AP (same clone as 15071-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 15071-1-AP (TOMM7 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 15071-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 15071-1-AP (same clone as 15071-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 15071-1-AP (TOMM7 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 15071-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 15071-1-AP (same clone as 15071-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 15071-1-AP (TOMM7 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 15071-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 15071-1-AP (same clone as 15071-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 15071-1-AP (TOMM7 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 15071-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TOMM7 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 15071-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

15071-1-PBS targets TOMM7 in IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7105

  Product name: Recombinant human TOMM7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-55 aa of BC001732

  Sequence: MVKLSKEAKQRLQQLFKGSQFAIRWGFIPLVIYLGFKRGADPGMPEPTVLSLLWG

• Full Name: translocase of outer mitochondrial membrane 7 homolog (yeast)
• Calculated Molecular Weight: 6 kDa
• Observed Molecular Weight: 6 kDa
• GenBank Accession Number: BC001732
• Gene Symbol: TOMM7
• Gene ID (NCBI): 54543
• RRID: AB_11232410
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9P0U1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.