TOR1B Polyclonal antibody, PBS Only

TOR1B Polyclonal Antibody for WB, Indirect ELISA
Cat No. 21945-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

21945-1-PBS targets TOR1B in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16641

Product name: Recombinant human TOR1B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 25-77 aa of BC015578

Sequence: FEPITVGLAIGAASAITGYLSYNDIYCRFAECCREERPLNASALKLDLEEKLF

Predict reactive species
Full Name torsin family 1, member B (torsin B)
Calculated Molecular Weight 336 aa, 38 kDa
Observed Molecular Weight 34 kDa
GenBank Accession NumberBC015578
Gene Symbol TOR1B
Gene ID (NCBI) 27348
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO14657
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Torsin A is 1 of 4 predicted mammalian torsin ATPases associated with assorted cellular activities (AAA+) proteins (PMID: 20015956). TOR1B (torsin family 1 member B), also called TorsinB (TorB), is similar to TorsinA at the sequence level. TorsinA and TorsinB are both ubiquitously expressed in all cell types though TorsinA is more highly expressed in neurons. TorsinA and TorsinB may be somewhat functionally redundant, with TorsinA being more important in neuronal cells and TorsinB being more important in other tissues (PMID: 24275647). TOR1B serve as a molecular chaperone assisting in the proper folding of secreted and/or membrane proteins,and plays a role in non-neural cells nuclear envelope and endoplasmic reticulum integrity (PMID: 24275647; 23569223).

Loading...
||
New chat Able
正在加载,请稍候...