TOR4A Polyclonal antibody

• 

  WB analysis using 31918-1-AP

  THP-1 cells, HCT 116 cells, HeLa cells lysates were subjected to SDS PAGE followed by western blot with 31918-1-AP (TOR4A antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

TOR4A Polyclonal Antibody for WB, ELISA

Cat No. 31918-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Torsin-4A, Torsin family 4 member A, C9orf167

---

Tested Applications

• Positive WB detected in: THP-1 cells, HCT 116 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31918-1-AP targets TOR4A in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36307

  Product name: Recombinant human C9orf167 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-121 aa of NM_017723

  Sequence: MDRGQPSLEPAAAAPRASGRCVIAPVRAVLRLRRRVCVLRKRRLLQPGGGPDVGTGAPRPGCSPRAPRADLDQPKFFTFDSPAELPSRTPRKKRRRSRLVLYPETSRKYRPRVEHRSRAQR

• Full Name: chromosome 9 open reading frame 167
• Calculated Molecular Weight: 46kDa
• Observed Molecular Weight: 38, 40 kDa
• GenBank Accession Number: NM_017723
• Gene Symbol: C9orf167
• Gene ID (NCBI): 54863
• RRID: AB_3670143
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9NXH8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TOR4A is known to be a member of the AAA+ ATPase superfamily of proteins that are involved in the degradation of misfolded proteins via the endoplasmic reticulum-associated protein degradation (ERAD) pathway (PMID: 25873482).TOR4A is an oncogene and that DNER acts as a tumor suppressor gene by inhibiting TOR4A and its functions of promoting p-AKT and inhibiting antiapoptotic protein expression (PMID: 36204885).