TP53RK Polyclonal antibody

• 

  WB analysis of Jurkat using 26818-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 26818-1-AP (TP53RK Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 26818-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 26818-1-AP (TP53RK Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of Jurkat using 26818-1-AP

  IP result of anti-TP53RK (IP:26818-1-AP, 4ug; Detection:26818-1-AP 1:700) with Jurkat cells lysate 3200ug.

• 

  IHC staining of human testis using 26818-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 26818-1-AP (TP53RK antibody) at dilution of 1:800 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human testis using 26818-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 26818-1-AP (TP53RK antibody) at dilution of 1:800 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

TP53RK Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 26818-1-AP

Publications(1)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IP, IHC, ELISA

Synonyms

BUD32, C20orf64, dJ101A2, Nori 2, Nori 2p, p53 related protein kinase, PRPK, TP53 regulating kinase, TP53RK

---

Tested Applications

• Positive WB detected in: Jurkat cells, HepG2 cells
• Positive IP detected in: Jurkat cells
• Positive IHC detected in: human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below

Product Information

26818-1-AP targets TP53RK in WB, IP, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25326

  Product name: Recombinant human TP53RK protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 154-253 aa of BC009727

  Sequence: HDEDLIHGDLTTSNMLLKPPLEQLNIVLIDFGLSFISALPEDKGVDLYVLEKAFLSTHPNTETVFEAFLKSYSTSSKKARPVLKKLDEVRLRGRKRSMVG

• Full Name: TP53 regulating kinase
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC009727
• Gene Symbol: TP53RK
• Gene ID (NCBI): 112858
• RRID: AB_2880647
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96S44
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Biol Med; Systematic screening for potential therapeutic targets in osteosarcoma through a kinome-wide CRISPR-Cas9 library.; Authors - Yuanzhong Wu ; KO Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Evangelia (Verified Customer) (10-05-2022)

It could be used in higher dilution. The 1/1000 works really strong.

• Applications: Immunofluorescence
• Primary Antibody Dilution: 1/1000
• Cell Tissue Type: -