Tested Applications
| Positive WB detected in | Jurkat cells, HepG2 cells |
| Positive IP detected in | Jurkat cells |
| Positive IHC detected in | human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26818-1-AP targets TP53RK in WB, IHC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25326 Product name: Recombinant human TP53RK protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 154-253 aa of BC009727 Sequence: HDEDLIHGDLTTSNMLLKPPLEQLNIVLIDFGLSFISALPEDKGVDLYVLEKAFLSTHPNTETVFEAFLKSYSTSSKKARPVLKKLDEVRLRGRKRSMVG Predict reactive species |
| Full Name | TP53 regulating kinase |
| Calculated Molecular Weight | 28 kDa |
| Observed Molecular Weight | 30 kDa |
| GenBank Accession Number | BC009727 |
| Gene Symbol | TP53RK |
| Gene ID (NCBI) | 112858 |
| RRID | AB_2880647 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96S44 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for TP53RK antibody 26818-1-AP | Download protocol |
| IP protocol for TP53RK antibody 26818-1-AP | Download protocol |
| WB protocol for TP53RK antibody 26818-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Cancer Biol Med Systematic screening for potential therapeutic targets in osteosarcoma through a kinome-wide CRISPR-Cas9 library.
| ||
Cell Rep Integrative 3D genome and epigenomic analysis identifies TP53RK and SYBU as critical regulators of stemness and anti-tumor immunity in HCC. |
Reviews
What customers say
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Evangelia (Verified Customer) (10-05-2022) | It could be used in higher dilution. The 1/1000 works really strong.
|

























