Tested Applications
Positive WB detected in | Jurkat cells, HepG2 cells |
Positive IP detected in | Jurkat cells |
Positive IHC detected in | human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 1 publications below |
Product Information
26818-1-AP targets TP53RK in WB, IP, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25326 Product name: Recombinant human TP53RK protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 154-253 aa of BC009727 Sequence: HDEDLIHGDLTTSNMLLKPPLEQLNIVLIDFGLSFISALPEDKGVDLYVLEKAFLSTHPNTETVFEAFLKSYSTSSKKARPVLKKLDEVRLRGRKRSMVG Predict reactive species |
Full Name | TP53 regulating kinase |
Calculated Molecular Weight | 28 kDa |
Observed Molecular Weight | 30 kDa |
GenBank Accession Number | BC009727 |
Gene Symbol | TP53RK |
Gene ID (NCBI) | 112858 |
RRID | AB_2880647 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q96S44 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TP53RK antibody 26818-1-AP | Download protocol |
IHC protocol for TP53RK antibody 26818-1-AP | Download protocol |
IP protocol for TP53RK antibody 26818-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Evangelia (Verified Customer) (10-05-2022) | It could be used in higher dilution. The 1/1000 works really strong.
|