Tested Applications
| Positive WB detected in | Jurkat cells, HepG2 cells |
| Positive IP detected in | Jurkat cells |
| Positive IHC detected in | human testis tissue, rat stomach tissue, human stomach cancer tissue, mouse heart tissue, rat heart tissue, mouse stomach tissue, human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26818-1-AP targets TP53RK in WB, IHC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25326 Product name: Recombinant human TP53RK protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 154-253 aa of BC009727 Sequence: HDEDLIHGDLTTSNMLLKPPLEQLNIVLIDFGLSFISALPEDKGVDLYVLEKAFLSTHPNTETVFEAFLKSYSTSSKKARPVLKKLDEVRLRGRKRSMVG Predict reactive species |
| Full Name | TP53 regulating kinase |
| Calculated Molecular Weight | 28 kDa |
| Observed Molecular Weight | 30 kDa |
| GenBank Accession Number | BC009727 |
| Gene Symbol | TP53RK |
| Gene ID (NCBI) | 112858 |
| RRID | AB_2880647 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96S44 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for TP53RK antibody 26818-1-AP | Download protocol |
| IP protocol for TP53RK antibody 26818-1-AP | Download protocol |
| WB protocol for TP53RK antibody 26818-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TP53RK Polyclonal antibody (Cat# 26818-1-AP) has 2 citations. One appears in Cancer Biology & Medicine, studying kinome-wide CRISPR-Cas9 screening for osteosarcoma therapeutic targets. The other is in Cell Reports, examining TP53RK as a regulator of stemness and anti-tumor immunity in hepatocellular carcinoma. Both citations fall within the research fields of cancer biology, specifically osteosarcoma and liver cancer, with applications in gene editing and epigenomic analysis.
| Species | Application | Title |
|---|---|---|
Cancer Biol Med Systematic screening for potential therapeutic targets in osteosarcoma through a kinome-wide CRISPR-Cas9 library.
| ||
Cell Rep Integrative 3D genome and epigenomic analysis identifies TP53RK and SYBU as critical regulators of stemness and anti-tumor immunity in HCC. |
Reviews
What customers say
The single review for this product is highly positive, rated 5 stars. The reviewer used it for immunofluorescence at a 1:1000 dilution and reported that it works very strongly at that dilution, noting it could even be used at higher dilutions. Overall, the feedback highlights strong performance and good dilution flexibility.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Evangelia (Verified Customer) (10-05-2022) | It could be used in higher dilution. The 1/1000 works really strong.
|
