TP73 Monoclonal antibody

• 

  WB analysis of MCF-7 using 66990-1-Ig

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 66990-1-Ig (TP73 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 66990-1-Ig

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66990-1-Ig (TP73 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HSC-T6 using 66990-1-Ig

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 66990-1-Ig (TP73 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 66990-1-Ig

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 66990-1-Ig (TP73 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of RAW 264.7 using 66990-1-Ig

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 66990-1-Ig (TP73 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 66990-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 66990-1-Ig (TP73 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 66990-1-Ig

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66990-1-Ig (TP73 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

TP73 Monoclonal Antibody for WB, ELISA

Cat No. 66990-1-Ig

Clone No.1D12A12

Publications(3)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, RIP, ELISA

Synonyms

1D12A12, P73, tumor protein p73

---

Tested Applications

• Positive WB detected in: MCF-7 cells, HeLa cells, HEK-293 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, RAW 264.7 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:20000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• RIP: See 1 publications below

Product Information

66990-1-Ig targets TP73 in WB, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26793

  Product name: Recombinant human TP73 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-100 aa of NM_001126240

  Sequence: MAQSTATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTSVMAQFNLLSSTMDQMSSRAASASPYTPEHAASVPTHSPYA

• Full Name: tumor protein p73
• Calculated Molecular Weight: 70 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: NM_001126240
• Gene Symbol: TP73
• Gene ID (NCBI): 7161
• RRID: AB_2882307
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O15350
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	RIP	Cell Rep; A p53/LINC00324 positive feedback loop suppresses tumor growth by counteracting SET-mediated transcriptional repression; Authors - Ling Zhang
human	WB	Biochem Pharmacol; Palmatine induces G2/M phase arrest and mitochondrial-associated pathway apoptosis in colon cancer cells by targeting AURKA.; Authors - Xiaojiang Liu
human	WB	Carcinogenesis; Construction and identification of lncRNA/circRNA coregulated ceRNA networks in gemcitabine-resistant bladder carcinoma; Authors - Jingjing Pan