Tested Applications
Positive WB detected in | MCF-7 cells, HeLa cells, HEK-293 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, RAW 264.7 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:5000-1:20000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
RIP | See 1 publications below |
Product Information
66990-1-Ig targets TP73 in WB, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Mouse / IgG1 |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26793 Product name: Recombinant human TP73 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-100 aa of NM_001126240 Sequence: MAQSTATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTSVMAQFNLLSSTMDQMSSRAASASPYTPEHAASVPTHSPYA Predict reactive species |
Full Name | tumor protein p73 |
Calculated Molecular Weight | 70 kDa |
Observed Molecular Weight | 70 kDa |
GenBank Accession Number | NM_001126240 |
Gene Symbol | TP73 |
Gene ID (NCBI) | 7161 |
RRID | AB_2882307 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein G purification |
UNIPROT ID | O15350 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TP73 antibody 66990-1-Ig | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Rep A p53/LINC00324 positive feedback loop suppresses tumor growth by counteracting SET-mediated transcriptional repression | ||
Biochem Pharmacol Palmatine induces G2/M phase arrest and mitochondrial-associated pathway apoptosis in colon cancer cells by targeting AURKA. | ||
Carcinogenesis Construction and identification of lncRNA/circRNA coregulated ceRNA networks in gemcitabine-resistant bladder carcinoma |