TP73 Monoclonal antibody, PBS Only

• 

  WB analysis of MCF-7 using 66990-1-Ig (same clone as 66990-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 66990-1-Ig (TP73 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66990-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 66990-1-Ig (same clone as 66990-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66990-1-Ig (TP73 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66990-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HSC-T6 using 66990-1-Ig (same clone as 66990-1-PBS)

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 66990-1-Ig (TP73 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66990-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 66990-1-Ig (same clone as 66990-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 66990-1-Ig (TP73 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66990-1-PBS in a different storage buffer formulation.

• 

  WB analysis of RAW 264.7 using 66990-1-Ig (same clone as 66990-1-PBS)

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 66990-1-Ig (TP73 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66990-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66990-1-Ig (same clone as 66990-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 66990-1-Ig (TP73 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66990-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 66990-1-Ig (same clone as 66990-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66990-1-Ig (TP73 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66990-1-PBS in a different storage buffer formulation.

TP73 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 66990-1-PBS

Clone No.1D12A12

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

1D12A12, P73, tumor protein p73

---

Product Information

66990-1-PBS targets TP73 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26793

  Product name: Recombinant human TP73 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-100 aa of NM_001126240

  Sequence: MAQSTATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTSVMAQFNLLSSTMDQMSSRAASASPYTPEHAASVPTHSPYA

• Full Name: tumor protein p73
• Calculated Molecular Weight: 70 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: NM_001126240
• Gene Symbol: TP73
• Gene ID (NCBI): 7161
• RRID: AB_2882307
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O15350
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.