TPRG1L Polyclonal antibody

• 

  WB analysis using 33038-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33038-1-AP (TPRG1L antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

TPRG1L Polyclonal Antibody for WB, ELISA

Cat No. 33038-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

FAM79A, h mover, Mossy fiber terminal-associated vertebrate-specific presynaptic protein, MOVER, Protein FAM79A

---

Tested Applications

• Positive WB detected in: SH-SY5Y cells, SK-N-SH cells, mouse kidney tissue, rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33038-1-AP targets TPRG1L in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37863

  Product name: Recombinant human TPRG1L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-90 aa of BC019034

  Sequence: MLQLRDSVDSAGTSPTAVLAAGEEVGAGGGPGGGRPGAGTPLRQTLWPLSIHDPTRRARVKEYFVFRPGSIEQAVEEIRVVVRPVEDGEI

• Full Name: tumor protein p63 regulated 1-like
• Observed Molecular Weight: 31 kDa
• GenBank Accession Number: BC019034
• Gene Symbol: TPRG1L
• Gene ID (NCBI): 127262
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q5T0D9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TPRG1L (Tumor protein p63-regulated gene 1-like protein) belongs to the presynaptic protein involved in the synaptic transmission tuning. It can regulate synaptic release probability by decreasing the calcium sensitivity of release. TPRG1L has two isoforms with molecular weights of 30kd and 23kd respectively.