TRA2A Polyclonal antibody

• 

  WB analysis using 30016-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30016-1-AP (TRA2A antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 30016-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30016-1-AP (TRA2A antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

TRA2A Polyclonal Antibody for WB, ELISA

Cat No. 30016-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse

Applications

WB, ELISA

Synonyms

HSU53209, TRA 2 alpha, TRA2 alpha, TRA2A

---

Tested Applications

• Positive WB detected in: A549 cells, mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30016-1-AP targets TRA2A in WB, ELISA applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30841

  Product name: Recombinant human TRA2A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2-97 aa of BC017094

  Sequence: SDVEENNFEGRESRSQSKSPTGTPARVKSESRSGSRSPSRVSKHSESHSRSRSKSRSRSRRHSHRRYTRSRSHSHSHRRRSRSRSYTPEYRRRRSR

• Full Name: transformer 2 alpha homolog (Drosophila)
• Calculated Molecular Weight: 282 aa, 33 kDa
• Observed Molecular Weight: 33-35 kDa
• GenBank Accession Number: BC017094
• Gene Symbol: TRA2A
• Gene ID (NCBI): 29896
• RRID: AB_2923629
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13595
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TRA2A is a sequence-specific RNA-binding protein which participates in the control of pre-mRNA splicing.