TRAF1 Polyclonal antibody

• 

  IHC staining of human tonsillitis using 26845-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 26845-1-AP (TRAF1 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human tonsillitis using 26845-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 26845-1-AP (TRAF1 Antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human spleen using 26845-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 26845-1-AP (TRAF1 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human spleen using 26845-1-AP

  Immunohistochemical analysis of paraffin-embedded human spleen tissue slide using 26845-1-AP (TRAF1 Antibody) at dilution of 1:200 (under 40x lens).

• 

  IF Staining of HUVEC using 26845-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed HUVEC cells using 26845-1-AP (TRAF1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

TRAF1 Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 26845-1-AP

Publications(10)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

EBI6, TRAF1

---

Tested Applications

• Positive IHC detected in: human tonsillitis tissue, human spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HUVEC cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 10 publications below
• IHC: See 1 publications below

Product Information

26845-1-AP targets TRAF1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25397

  Product name: Recombinant human TRAF1 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 173-295 aa of BC024145

  Sequence: QEELALQHFMKEKLLAELEGKLRVFENIVAVLNKEVEASHLALATSIHQSQLDRERILSLEQRVVELQQTLAQKDQALGKLEQSLRLMEEASFDGTFLWKITNVTRRCHESACGRTVSLFSPA

• Full Name: TNF receptor-associated factor 1
• Calculated Molecular Weight: 416 aa, 46 kDa
• GenBank Accession Number: BC024145
• Gene Symbol: TRAF1
• Gene ID (NCBI): 7185
• RRID: AB_2880655
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13077
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Lett; Up-regulation of OLR1 expression by TBC1D3 through activation of TNFα/NF-κB pathway promotes the migration of human breast cancer cells.; Authors - Bei Wang
rat	WB	J Cell Mol Med; Exercise ameliorates insulin resistance and improves ASK1-mediated insulin signalling in obese rats.; Authors - Yong Zhang
human	WB	Front Pharmacol; Anthraquinone Emodin Inhibits Tumor Necrosis Factor Alpha-Induced Calcification of Human Aortic Valve Interstitial Cells via the NF-κB Pathway.; Authors - Kang Xu
human	WB	Int Immunopharmacol; Autoinducer-2 of Fusobacterium nucleatum promotes macrophage M1 polarization via TNFSF9/IL-1β signaling.; Authors - Jiao Wu
human	WB	Dose Response; Scutellarin Inhibits Glioblastoma Growth in a Dose-dependent Manner by Suppressing the p63 Signaling Pathway; Authors - Yongjie Chen
human	WB	Int Urol Nephrol; TRAIP suppressed apoptosis and cell cycle to promote prostate cancer proliferation via TRAF2-PI3K-AKT pathway activation; Authors - Yuan Gu