Tested Applications
Positive IHC detected in | human tonsillitis tissue, human spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HUVEC cells |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 10 publications below |
IHC | See 1 publications below |
Product Information
26845-1-AP targets TRAF1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25397 Product name: Recombinant human TRAF1 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 173-295 aa of BC024145 Sequence: QEELALQHFMKEKLLAELEGKLRVFENIVAVLNKEVEASHLALATSIHQSQLDRERILSLEQRVVELQQTLAQKDQALGKLEQSLRLMEEASFDGTFLWKITNVTRRCHESACGRTVSLFSPA Predict reactive species |
Full Name | TNF receptor-associated factor 1 |
Calculated Molecular Weight | 416 aa, 46 kDa |
GenBank Accession Number | BC024145 |
Gene Symbol | TRAF1 |
Gene ID (NCBI) | 7185 |
RRID | AB_2880655 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q13077 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for TRAF1 antibody 26845-1-AP | Download protocol |
IF protocol for TRAF1 antibody 26845-1-AP | Download protocol |
FC protocol for TRAF1 antibody 26845-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cancer Lett Up-regulation of OLR1 expression by TBC1D3 through activation of TNFα/NF-κB pathway promotes the migration of human breast cancer cells. | ||
J Cell Mol Med Exercise ameliorates insulin resistance and improves ASK1-mediated insulin signalling in obese rats. | ||
Front Pharmacol Anthraquinone Emodin Inhibits Tumor Necrosis Factor Alpha-Induced Calcification of Human Aortic Valve Interstitial Cells via the NF-κB Pathway. | ||
Int Immunopharmacol Autoinducer-2 of Fusobacterium nucleatum promotes macrophage M1 polarization via TNFSF9/IL-1β signaling. | ||
Dose Response Scutellarin Inhibits Glioblastoma Growth in a Dose-dependent Manner by Suppressing the p63 Signaling Pathway | ||
Int Urol Nephrol TRAIP suppressed apoptosis and cell cycle to promote prostate cancer proliferation via TRAF2-PI3K-AKT pathway activation |