TRAF2 Monoclonal antibody

• 

  WB analysis of HepG2 using 67315-1-Ig

  HepG2 cells were subjected to SDS PAGE followed by western blot with 67315-1-Ig (TRAF2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

TRAF2 Monoclonal Antibody for ELISA

Cat No. 67315-1-Ig

Clone No.2A4D1

Publications(7)

Host / Isotype

Mouse / IgG2a

Reactivity

human and More (1)

Applications

WB, IP, ELISA

Synonyms

E3 ubiquitin-protein ligase TRAF2, EC:2.3.2.27, RING-type E3 ubiquitin transferase TRAF2, TNF receptor-associated factor 2, TRAP

---

Published Applications

• KD/KO: See 2 publications below
• WB: See 6 publications below
• IP: See 1 publications below

Product Information

67315-1-Ig targets TRAF2 in WB, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25387

  Product name: Recombinant human TRAF2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 438-501 aa of BC032410

  Sequence: NNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL

• Full Name: TNF receptor-associated factor 2
• Calculated Molecular Weight: 56 kDa
• Observed Molecular Weight: 53 kDa
• GenBank Accession Number: BC032410
• Gene Symbol: TRAF2
• Gene ID (NCBI): 7186
• RRID: AB_2882575
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q12933
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Cell Rep; Liquidambaric acid inhibits Wnt/β-catenin signaling and colon cancer via targeting TNF receptor-associated factor 2.; Authors - Rong Yan
human	WB	J Ethnopharmacol; Extract of Nanhaia speciosa J. Compton & Schrire alleviates LPS-induced acute lung injury via the NF-κB/Nrf2/AQPs pathway; Authors - Shiyao Zhou
human	WB	Aging (Albany NY); Implications of the KHDC4-TRAF2 axis in the context of prostate cancer prognosis; Authors - Su-Wei Hu ; KD Validated
human	WB	Cell Rep; KIF26B promotes bladder cancer progression via activating Wnt/β-catenin signaling in a TRAF2-dependent pathway; Authors - Jia-Ming Wang
mouse	WB	Int J Biol Macromol; Bilobalide ameliorates ovariectomy-induced osteoporosis by influencing SIRT3/NF-κB axis in osteoclast and promoting M2 polarization in macrophages; Authors - YiFang Qin
human	WB,IP	FEBS J; TRAF2 associates with cullin neddylation complex assembly; Authors - Tiantian Wang ; KO Validated