TRAF5 Monoclonal antibody, PBS Only

TRAF5 Monoclonal Antibody for WB, Indirect ELISA
Cat No. 66991-1-PBS
Clone No.1B1A7

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, Indirect ELISA

1B1A7, RING finger protein 84, RNF84, TNF receptor associated factor 5, TNF receptor-associated factor 5

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66991-1-PBS targets TRAF5 in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag26070

Product name: Recombinant human TRAF5 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-60 aa of BC029600

Sequence: MAYSEEHKGMPCGFIRQNSGNSISLDFEPSIEYQFVERLEERYKCAFCHSVLHNPHQTGC

Predict reactive species
Full Name TNF receptor-associated factor 5
Calculated Molecular Weight 557 aa, 64 kDa
Observed Molecular Weight 64 kDa
GenBank Accession NumberBC029600
Gene Symbol TRAF5
Gene ID (NCBI) 7188
RRIDAB_2882308
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO00463
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

TRAF5 (also known as TNF receptor-associated factor 5, Ring finger protein 84, RNF8, MGC:39780) is a member of the tumor necrosis factor receptor-associated (TRAF) family of proteins that are characterized by the presence of a meprin and TRAF homology (MATH) domain, a RING-type zinc finger domain, and two TRAF-type zinc finger domains (https://www.uniprot.org/uniprot/O00463). TRAF5 is a scaffold protein that associates with and mediates signal transduction by cell surface receptors belonging to the tumor necrosis factor (TNF) superfamily, including CD27, CD30, CD40, and lymphotoxin-β receptor, positively regulating activation of the canonical NF-κB pathway and c-Jun NH2-terminal kinase (JNK) activation by these receptors (PMIDs: 8999898, 9582383, 8790348, 8663299). The RING-type zinc finger domain of TRAF5 exhibits ubiquitin protein ligase activity and is responsible for Lys-63-linked polyubiquitination of protein targets (PMIDs:23758787, 29176576). This domain has been demonstrated to be required for TRAF5-mediated activation of NF-κB (PMID:8663299).

Loading...
||
New chat Able
正在加载,请稍候...