Product Information
66991-1-PBS targets TRAF5 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26070 Product name: Recombinant human TRAF5 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-60 aa of BC029600 Sequence: MAYSEEHKGMPCGFIRQNSGNSISLDFEPSIEYQFVERLEERYKCAFCHSVLHNPHQTGC Predict reactive species |
| Full Name | TNF receptor-associated factor 5 |
| Calculated Molecular Weight | 557 aa, 64 kDa |
| Observed Molecular Weight | 64 kDa |
| GenBank Accession Number | BC029600 |
| Gene Symbol | TRAF5 |
| Gene ID (NCBI) | 7188 |
| RRID | AB_2882308 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | O00463 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
TRAF5 (also known as TNF receptor-associated factor 5, Ring finger protein 84, RNF8, MGC:39780) is a member of the tumor necrosis factor receptor-associated (TRAF) family of proteins that are characterized by the presence of a meprin and TRAF homology (MATH) domain, a RING-type zinc finger domain, and two TRAF-type zinc finger domains (https://www.uniprot.org/uniprot/O00463). TRAF5 is a scaffold protein that associates with and mediates signal transduction by cell surface receptors belonging to the tumor necrosis factor (TNF) superfamily, including CD27, CD30, CD40, and lymphotoxin-β receptor, positively regulating activation of the canonical NF-κB pathway and c-Jun NH2-terminal kinase (JNK) activation by these receptors (PMIDs: 8999898, 9582383, 8790348, 8663299). The RING-type zinc finger domain of TRAF5 exhibits ubiquitin protein ligase activity and is responsible for Lys-63-linked polyubiquitination of protein targets (PMIDs:23758787, 29176576). This domain has been demonstrated to be required for TRAF5-mediated activation of NF-κB (PMID:8663299).





