Tested Applications
| Positive WB detected in | HepG2 cells, Sp2/0 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 1 publications below |
Product Information
13311-1-AP targets TRAM2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4144 Product name: Recombinant human TRAM2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 300-370 aa of BC028121 Sequence: CAAQAWLMWRFIHSQLRHWREYWNEQSAKRRVPATPRLPARLIKRESGYHENGVVKAENGTSPRTKKLKSP Predict reactive species |
| Full Name | translocation associated membrane protein 2 |
| Calculated Molecular Weight | 370 aa, 43 kDa |
| Observed Molecular Weight | 43 kDa, 66 kDa |
| GenBank Accession Number | BC028121 |
| Gene Symbol | TRAM2 |
| Gene ID (NCBI) | 9697 |
| RRID | AB_10598476 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15035 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for TRAM2 antibody 13311-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





