TRAM2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TRAM2 Polyclonal antibody (13311-1-AP)

• Featured Product
• KD/KO Validated

TRAM2 Polyclonal Antibody for WB, ELISA

Cat No. 13311-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

KIAA0057, TRAM2

• 

  WB analysis of HepG2 using 13311-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 13311-1-AP (TRAM2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Sp2/0 using 13311-1-AP

  Sp2/0 cells were subjected to SDS PAGE followed by western blot with 13311-1-AP (TRAM2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 13311-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 13311-1-AP (TRAM2 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TRAM2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HepG2 cells, Sp2/0 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13311-1-AP targets TRAM2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4144

  Product name: Recombinant human TRAM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 300-370 aa of BC028121

  Sequence: CAAQAWLMWRFIHSQLRHWREYWNEQSAKRRVPATPRLPARLIKRESGYHENGVVKAENGTSPRTKKLKSP

• Full Name: translocation associated membrane protein 2
• Calculated Molecular Weight: 370 aa, 43 kDa
• Observed Molecular Weight: 43 kDa, 66 kDa
• GenBank Accession Number: BC028121
• Gene Symbol: TRAM2
• Gene ID (NCBI): 9697
• RRID: AB_10598476
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15035
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The TRAM2 Polyclonal antibody (Cat# 13311-1-AP) has 1 citation. It was used in a study published in Frontiers in Immunology (2022), which performed a comprehensive analysis of glycolysis and cholesterol synthesis-related gene signatures for predicting prognosis and immune landscape in osteosarcoma. The research fields associated with this citation include cancer biology (osteosarcoma), metabolic pathways (glycolysis and cholesterol synthesis), and immunology (immune landscape).

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Immunol; Comprehensive analysis of a glycolysis and cholesterol synthesis-related genes signature for predicting prognosis and immune landscape in osteosarcoma; Authors - Fangxing Xu ; KD Validated