TRAM2 Polyclonal antibody, PBS Only

• 

  WB analysis of HepG2 using 13311-1-AP (same clone as 13311-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 13311-1-AP (TRAM2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13311-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Sp2/0 using 13311-1-AP (same clone as 13311-1-PBS)

  Sp2/0 cells were subjected to SDS PAGE followed by western blot with 13311-1-AP (TRAM2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13311-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 13311-1-AP (same clone as 13311-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 13311-1-AP (TRAM2 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13311-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TRAM2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 13311-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

13311-1-PBS targets TRAM2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4144

  Product name: Recombinant human TRAM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 300-370 aa of BC028121

  Sequence: CAAQAWLMWRFIHSQLRHWREYWNEQSAKRRVPATPRLPARLIKRESGYHENGVVKAENGTSPRTKKLKSP

• Full Name: translocation associated membrane protein 2
• Calculated Molecular Weight: 370 aa, 43 kDa
• Observed Molecular Weight: 43 kDa, 66 kDa
• GenBank Accession Number: BC028121
• Gene Symbol: TRAM2
• Gene ID (NCBI): 9697
• RRID: AB_10598476
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15035
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.