TREM2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of THP-1 using 83438-6-RR (same clone as 83438-6-PBS)

  PMA treated THP-1 cells were subjected to SDS PAGE followed by western blot with 83438-6-RR (TREM2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83438-6-PBS in a different storage buffer formulation.

• 

  WB analysis of THP-1 using 83438-6-RR (same clone as 83438-6-PBS)

  Non-treated and PMA treated THP-1 cellls were subjected to SDS PAGE followed by western blot with 83438-6-RR (TREM2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83438-6-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83438-6-RR

  Biolayer interferometry (BLl) kinetic assays of 83438-6-RR against Human TREM2 were performed. The affinity constant is 38.7 nM.

TREM2 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 83438-6-PBS

Clone No.240384B7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

240384B7, TREM 2, TREM-2, Trem2a, Trem2b

---

Product Information

83438-6-PBS targets TREM2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0747

  Product name: Recombinant human TREM2 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 19-174 aa of BC032362

  Sequence: HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRPSQGSHLPSCLSK

• Full Name: triggering receptor expressed on myeloid cells 2
• Calculated Molecular Weight: 222 aa, 25 kDa
• Observed Molecular Weight: 26-32 kDa
• GenBank Accession Number: BC032362
• Gene Symbol: TREM2
• Gene ID (NCBI): 54209
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9NZC2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TREM2 (triggering receptor expressed on myeloid cells 2) is a cell surface receptor belongs to TREM family that is expressed on osteoclast, dendritic cells, macrophages, nature killers, neutrophils and microglia (PMID: 19302484). TREM2 is localized predominantly in the Golgi complex, but also shuttles to and from the cell surface in endocytic and exocytic vesicles (PMID: 16675145). TREM2 associates with DAP12 to initiate the intracellular signalling cascade via an immunoreceptor tyrosine-based activation motif (ITAM) domain and tyrosine-kinases (PMID: 23977213).