TRHR Polyclonal antibody

• 

  WB analysis using 23872-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 23872-1-AP (TRHR antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

TRHR Polyclonal Antibody for WB, ELISA

Cat No. 23872-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

Thyroliberin receptor, TRH R

---

Tested Applications

• Positive WB detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

23872-1-AP targets TRHR in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20612

  Product name: Recombinant human TRHR protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 310-398 aa of BC113360

  Sequence: YLNSAINPVIYNLMSQKFRAAFRKLCNCKQKPTEKPANYSVALNYSVIKESDHFSTELDDITVTDTYLSATKVSFDDTCLASEVSFSQS

• Full Name: thyrotropin-releasing hormone receptor
• Calculated Molecular Weight: 398 aa, 45 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC113360
• Gene Symbol: TRHR
• Gene ID (NCBI): 7201
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: P34981
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TRHR is a Gq-coupled neuroendocrine GPCR that mediates the actions of thyrotropin-releasing hormone in the anterior pituitary and brain. By activating PLC-Ca²⁺ signaling, TRHR controls TSH secretion, regulates thyroid hormone output, and influences metabolic rate and neuroendocrine behavior. Genetic or functional disruption of TRHR leads to central hypothyroidism and broader metabolic and neurological consequences, highlighting its essential role in HPT axis regulation.