TRIM2 Monoclonal antibody, PBS Only (Capture)

TRIM2 Monoclonal Antibody for WB, IHC, IF-P, Cytometric bead array, Indirect ELISA

Cat No. 67342-1-PBS
Clone No.1H9C2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF-P, Cytometric bead array, Indirect ELISA

1H9C2, E3 ubiquitin-protein ligase TRIM2, EC:2.3.2.27, KIAA0517, RING-type E3 ubiquitin transferase TRIM2

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67342-1-PBS targets TRIM2 as part of a matched antibody pair:

MP51520-1: 67342-1-PBS capture and 67342-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag14637

Product name: Recombinant human TRIM2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-300 aa of BC011052

Sequence: MASEGTNIPSPVVRQIDKQFLICSICLERYKNPKVLPCLHTFCERCLQNYIPAHSLTLSCPVCRQTSILPEKGVAALQNNFFITNLMDVLQRTPGSNAEESSILETVTAVAAGKPLSCPNHDGNVMEFYCQSCETAMCRECTEGEHAEHPTVPLKDVVEQHKASLQVQLDAVNKRLPEIDSALQFISEIIHQLTNQKASIVDDIHSTFDELQKTLNVRKSVLLMELEVNYGLKHKVLQSQLDTLLQGQESIKSCSNFTAQALNHGTETEVLLVKKQMSEKLNELADQDFPLHPRENDQLD

Predict reactive species
Full Name tripartite motif-containing 2
Calculated Molecular Weight 744 aa, 82 kDa
Observed Molecular Weight 70-85 kDa
GenBank Accession NumberBC011052
Gene Symbol TRIM2
Gene ID (NCBI) 23321
RRIDAB_2882600
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ9C040
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Tripartite motif-containing 2(TRIM2) is an E3 ubiquitin ligase which directs proteasome-mediated degradation of target proteins by the ubiquitination of NEFL and phosphorylation of BCL2L11. This protein contains an N-terminal RING domain, followed by a B-box-2 domain, a coiled-coil region, and 6 C-terminal NHL repeats. TRIM2 involves in the apoptotic response to ischemia via directing degradation of BIM protein, thus has a role in neuroprotection.

Loading...
||
New chat

Able

正在加载,请稍候...