Tested Applications
| Positive WB detected in | HEK-293 cells, A549 cells, HeLa cells, HL-60 cells, HT-1080 cells, HT-29 cells, MCF-7 cells |
| Positive IP detected in | HT-29 cells |
| Positive IHC detected in | human pancreas cancer tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12108-1-AP targets TRIM21 in WB, IHC, IF/ICC, IP, coIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat, pig, hamster |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2753 Product name: Recombinant human TRIM21 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 176-475 aa of BC010861 Sequence: SRIHAEFVQQKNFLVEEEQRQLQELEKDEREQLRILGEKEAKLAQQSQALQELISELDRRCHSSALELLQEVIIVLERSESWNLKDLDITSPELRSVCHVPGLKKMLRTCAVHITLDPDTANPWLILSEDRRQVRLGDTQQSIPGNEERFDSYPMVLGAQHFHSGKHYWEVDVTGKEAWDLGVCRDSVRRKGHFLLSSKSGFWTIWLWNKQKYEAGTYPQTPLHLQVPPCQVGIFLDYEAGMVSFYNITDHGSLIYSFSECAFTGPLRPFFSPGFNDGGKNTAPLTLCPLNIGSQGSTDY Predict reactive species |
| Full Name | tripartite motif-containing 21 |
| Calculated Molecular Weight | 475 aa, 54 kDa |
| Observed Molecular Weight | 42-45 kDa, 49-54 kDa |
| GenBank Accession Number | BC010861 |
| Gene Symbol | TRIM21 |
| Gene ID (NCBI) | 6737 |
| RRID | AB_2209469 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P19474 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TRIM21 has multiple N-terminal zinc finger motifs(has E3 ligase activity), a central leucine zipper, and a potential N-glycosylation site. TRIM21 is a E3 ubiquitin-protein ligase. It can form a ubiquitin ligase complex with E2 UBE2D2, which function not only for the uniquitination of USP4 and IKBKB but also for its self-ubiquitination. It has a role in the regulation of the cell cycle progression and could enhance the decapping activity of DCP2. It can exist in all mammalian cells as a ribonucleoprotein particle , which composed of a single polypeptide and 1 of 4 small RNA molecules. TRIM21 exists various isoforms and range molecular weight of isoforms is about 42-45kDa and 49-54 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TRIM21 antibody 12108-1-AP | Download protocol |
| IHC protocol for TRIM21 antibody 12108-1-AP | Download protocol |
| IP protocol for TRIM21 antibody 12108-1-AP | Download protocol |
| WB protocol for TRIM21 antibody 12108-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TRIM21 Polyclonal antibody (catalog number 12108-1-AP) has 135 citations. These appear in high-impact journals including Cancer Cell, Cell Metabolism, Blood, Nature Communications, Science Advances, Cell Death & Disease, Oncogene, Autophagy, Journal of Clinical Investigation, EMBO Reports, and PNAS. Research fields span oncology (tumor progression, metastasis, chemoresistance), ubiquitination and protein degradation, autophagy, ferroptosis, viral infections, inflammation, and metabolic disorders. Applications are predominantly Western blot, immunoprecipitation, and immunohistochemistry.
| Species | Application | Title |
|---|---|---|
Cancer Cell Mapping cell type-resolved transcriptomic profiles to patient survival in pancreatic cancer. | ||
Cell Metab UBE2M-mediated neddylation of TRIM21 regulates obesity-induced inflammation and metabolic disorders | ||
Cancer Commun (Lond) USP51/PD-L1/ITGB1-deployed juxtacrine interaction plays a cell-intrinsic role in promoting chemoresistant phenotypes in non-small cell lung cancer | ||
Bioact Mater Engineered mesenchymal stem cell-derived small extracellular vesicles for diabetic retinopathy therapy through HIF-1α/EZH2/PGC-1α pathway
| ||
Autophagy Dual roles of CXCR4 (C-X-C motif chemokine receptor 4) in promoting entry of ebolavirus and targeting excessive glycoprotein for reticulophagic degradation to facilitate viral fitness |
Reviews
What customers say
Customers consistently rate this antibody 4–5 stars across six reviews. Users report strong, clear, and precise Western blot bands, often successful on the first attempt. It is described as reliable for both WB and immunofluorescence, detecting TRIM21 basal and fusion proteins in cell lines such as HEK293T, SH-SY5Y, and pancreatic beta cells. Typical dilutions are 1:500 for WB and 1:200 for IF. Several reviewers note routine, repeat use, highlighting its consistency and clean results across multiple applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
fei (Verified Customer) (10-02-2025) | this Ab is very good. I got strong and clear bands.
|
Madison (Verified Customer) (05-28-2024) | The western blot showed very clear bands and had really precise staining. We got exactly what we wanted from the antibody on the first try
 |
Paul (Verified Customer) (01-14-2020) | Used routinely for Western Blot.
|
Laura (Verified Customer) (01-14-2020) | Gives a clean Western blot.
|
Benjamin (Verified Customer) (01-10-2020) | Used many times in many WB and IF applications. Reliably antibody which detects TRIM21 basal as well as fusion proteins in WB and can be used to visualise TRIM21 in cells through IF.
|
Alinda (Verified Customer) (09-11-2019) | HEK were transfected with a TRIM21 overexpression vector- secondary anitbody used was rb Alexa 488.
 |
