Tested Applications
| Positive WB detected in | HEK-293 cells, A549 cells, HeLa cells, HL-60 cells, HT-1080 cells, HT-29 cells, MCF-7 cells |
| Positive IP detected in | HT-29 cells |
| Positive IHC detected in | human pancreas cancer tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells, A549 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 30 publications below |
| WB | See 78 publications below |
| IHC | See 25 publications below |
| IF | See 29 publications below |
| IP | See 22 publications below |
| CoIP | See 15 publications below |
Product Information
12108-1-AP targets TRIM21 in WB, IHC, IF/ICC, IP, coIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat, pig, hamster |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2753 Product name: Recombinant human TRIM21 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 176-475 aa of BC010861 Sequence: SRIHAEFVQQKNFLVEEEQRQLQELEKDEREQLRILGEKEAKLAQQSQALQELISELDRRCHSSALELLQEVIIVLERSESWNLKDLDITSPELRSVCHVPGLKKMLRTCAVHITLDPDTANPWLILSEDRRQVRLGDTQQSIPGNEERFDSYPMVLGAQHFHSGKHYWEVDVTGKEAWDLGVCRDSVRRKGHFLLSSKSGFWTIWLWNKQKYEAGTYPQTPLHLQVPPCQVGIFLDYEAGMVSFYNITDHGSLIYSFSECAFTGPLRPFFSPGFNDGGKNTAPLTLCPLNIGSQGSTDY Predict reactive species |
| Full Name | tripartite motif-containing 21 |
| Calculated Molecular Weight | 475 aa, 54 kDa |
| Observed Molecular Weight | 42-45 kDa, 49-54 kDa |
| GenBank Accession Number | BC010861 |
| Gene Symbol | TRIM21 |
| Gene ID (NCBI) | 6737 |
| RRID | AB_2209469 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P19474 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TRIM21 has multiple N-terminal zinc finger motifs(has E3 ligase activity), a central leucine zipper, and a potential N-glycosylation site. TRIM21 is a E3 ubiquitin-protein ligase. It can form a ubiquitin ligase complex with E2 UBE2D2, which function not only for the uniquitination of USP4 and IKBKB but also for its self-ubiquitination. It has a role in the regulation of the cell cycle progression and could enhance the decapping activity of DCP2. It can exist in all mammalian cells as a ribonucleoprotein particle , which composed of a single polypeptide and 1 of 4 small RNA molecules. TRIM21 exists various isoforms and range molecular weight of isoforms is about 42-45kDa and 49-54 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TRIM21 antibody 12108-1-AP | Download protocol |
| IHC protocol for TRIM21 antibody 12108-1-AP | Download protocol |
| IP protocol for TRIM21 antibody 12108-1-AP | Download protocol |
| WB protocol for TRIM21 antibody 12108-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Clin Invest The ubiquitin ligase TRIM21 regulates mutant p53 accumulation and gain-of-function in cancer | ||
Nat Commun Elaboration of molecular glues that target TRIM21 into TRIMTACs that degrade protein aggregates
| ||
Adv Sci (Weinh) SUCLG2 Regulates Mitochondrial Dysfunction through Succinylation in Lung Adenocarcinoma | ||
Autophagy Stress granule homeostasis is modulated by TRIM21-mediated ubiquitination of G3BP1 and autophagy-dependent elimination of stress granules
| ||
Nat Commun Inhibition of the CDK2 and Cyclin A complex leads to autophagic degradation of CDK2 in cancer cells. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH fei (Verified Customer) (10-02-2025) | this Ab is very good. I got strong and clear bands.
|
FH Madison (Verified Customer) (05-28-2024) | The western blot showed very clear bands and had really precise staining. We got exactly what we wanted from the antibody on the first try
|
FH Paul (Verified Customer) (01-14-2020) | Used routinely for Western Blot.
|
FH Laura (Verified Customer) (01-14-2020) | Gives a clean Western blot.
|
FH Benjamin (Verified Customer) (01-10-2020) | Used many times in many WB and IF applications. Reliably antibody which detects TRIM21 basal as well as fusion proteins in WB and can be used to visualise TRIM21 in cells through IF.
|
FH Alinda (Verified Customer) (09-11-2019) | HEK were transfected with a TRIM21 overexpression vector- secondary anitbody used was rb Alexa 488.
![]() |
































