TRIM26 Polyclonal antibody

• 

  WB analysis using 27013-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27013-1-AP (TRIM26 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 27013-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27013-1-AP (TRIM26 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 27013-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 27013-1-AP (TRIM26 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of RAW 264.7 using 27013-1-AP

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 27013-1-AP (TRIM26 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 27013-1-AP

  IP result of anti-TRIM26 (IP:27013-1-AP, 4ug; Detection:27013-1-AP 1:300) with HeLa cells lysate 2400ug.

• 

  IHC staining of human pancreas cancer using 27013-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 27013-1-AP (TRIM26 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 27013-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 27013-1-AP (TRIM26 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 27013-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 27013-1-AP (TRIM26 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 27013-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 27013-1-AP (TRIM26 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 27013-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 27013-1-AP (TRIM26 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 27013-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 27013-1-AP (TRIM26 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

TRIM26 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 27013-1-AP

Publications(9)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, IP, ELISA

Synonyms

Acid finger protein, AFP, RING finger protein 95, RNF95, TRIM26, tripartite motif containing 26, Zinc finger protein 173, ZNF173

---

Tested Applications

• Positive WB detected in: HEK-293T cells, mouse testis tissue, RAW 264.7 cells, HeLa cells, HepG2 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human pancreas cancer tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 8 publications below
• IHC: See 2 publications below
• IF: See 2 publications below
• IP: See 1 publications below

Product Information

27013-1-AP targets TRIM26 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25546

  Product name: Recombinant human TRIM26 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 151-270 aa of BC024039

  Sequence: NHLSTLRRDRDKIQGFQAKGEADILAALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLALVISELEGKAQQPAAELMQDTRDFLNRYPRKKFW

• Full Name: tripartite motif-containing 26
• Calculated Molecular Weight: 62 kDa
• Observed Molecular Weight: 62 kDa
• GenBank Accession Number: BC024039
• Gene Symbol: TRIM26
• Gene ID (NCBI): 7726
• RRID: AB_2880721
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q12899
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TRIM26 is a member of the tripartite motif (TRIM) protein family composed of more than 70 members in human. TRIM proteins share a similar characteristic structure, which includes a RING (R) domain, one or two B-boxes (B), and a coiled coil (CC) domain in the N-terminal and a domain in the C-terminal with variable structures. TRIM26 potentiates virus-triggered IRF3, NF-κB activation, IFN-β induction, and cellular antiviral responses. Further investigation suggests that TRIM26 plays an important role in the antiviral innate immune response by bridging TBK1 to NEMO and mediating TBK1 activation. (PMID: 25763818, PMID: 26611359)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Cell Death Dis; The E3 ligase TRIM26 suppresses ferroptosis through catalyzing K63-linked ubiquitination of GPX4 in glioma; Authors - Zhangjie Wang
pig	WB	Virus Res; TRIM26-mediated degradation of nucleocapsid protein limits porcine reproductive and respiratory syndrome virus-2 infection.; Authors - Pandeng Zhao
mouse	WB	Cell Death Dis; USP39 stabilizes β-catenin by deubiquitination and suppressing E3 ligase TRIM26 pre-mRNA maturation to promote HCC progression; Authors - Weiwei Wang
human	WB,IHC,IF,IP	Int J Biol Sci; TRIM26 promotes non-small cell lung cancer survival by inducing PBX1 degradation; Authors - Yuening Sun ; KD Validated
human	WB,IF	FASEB J; TRIM26 restricts Epstein-Barr virus infection in nasopharyngeal epithelial cells through K48-linked ubiquitination of HSP-90β; Authors - Mingjiao Zhang ; KD Validated
human	WB	Aging (Albany NY); Machine learning-based identification and immune characterization of ferroptosis-related molecular clusters in osteoarthritis and validation; Authors - Xiaocheng Guo

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Xingyuan (Verified Customer) (03-20-2024)

Protein quality was good.

• Applications: Western Blot
• Primary Antibody Dilution: 1:2500
• Cell Tissue Type: HEK293T

TRIM26 Antibody Western Blot validation (1:2500 dilution) in HEK293T (Cat no:27013-1-AP)